Study : Lmo1051 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C6_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C6_S1
Complex: FMT_D_16(4DR8) / Model_30(4DR8/D) = [3.1] Download154.5012.27MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQDEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACLSGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMFYDHINKENPSYLPPDVDVFG
Complex: GLY_B_5(1Y6H) / Model_38(1Y6H/B) = [3.2] Download2622.4229.98MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQDEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACLSGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMFYDHINKENPSYLPPDVDVFG
Complex: BB2_B_6(2OKL) / Model_1(2OKL/A) = [3.2] Download1920.2820.85MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQDEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACLSGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMFYDHINKENPSYLPPDVDVFG
Complex: FMT_A_12(1VEZ) / Model_41(1VEZ/A) = [3.2] Download143.5413.50MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQDEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACLSGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMFYDHINKENPSYLPPDVDVFG
Complex: FMT_B_18(1VEZ) / Model_40(1VEZ/B) = [3.2] Download251.859.85MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQDEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACLSGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMFYDHINKENPSYLPPDVDVFG
Consensus
[pKd Mean = 3.18]
-1018
(s=1047)
17
(s=7)
MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQDEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACLSGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMFYDHINKENPSYLPPDVDVFG