@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1051: (2016-03-21 )
MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQDEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACLSGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMFYDHINKENPSYLPPDVDVFG

Atome Classification :

(85 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SB8_A_4(2AIA)
DEF_STRR6
[Raw transfer]




BB2_A_6(2OS1)
DEF_ENTFA
[Raw transfer]




BB2_C_14(4DR9)
?
[Raw transfer]




BB2_A_3(2OS3)
DEF_STRP1
[Raw transfer]




BB2_B_7(2OKL)
DEF2_BACCR
[Raw transfer]




2BB_A_5(3K6L)
DEF_ECOLI
[Raw transfer]




EPE_B_6(1VEY)
DEF_LEPIN
[Raw transfer]




BB2_D_17(4DR9)
?
[Raw transfer]




BB2_A_4(1LQY)
DEF2_GEOSE
[Raw transfer]




BB2_B_10(4DR9)
?
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




BB2_A_9(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_7(4DR9)
?
[Raw transfer]




EPE_A_5(1VEY)
DEF_LEPIN
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB1_B_8(1G27)
DEF_ECOLI
[Raw transfer]




BB2_C_11(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




BB2_B_8(1G2A)
DEF_ECOLI
[Raw transfer]




2BB_B_7(3K6L)
DEF_ECOLI
[Raw transfer]




BB2_A_5(2OKL)
DEF2_BACCR
[Raw transfer]




BB2_B_10(1LRU)
DEF_ECOLI
[Raw transfer]




SB7_A_4(2AI7)
DEF_STRR6
[Raw transfer]




BB1_C_9(1G27)
DEF_ECOLI
[Raw transfer]




SB9_P_4(2AIE)
DEF_STRR6
[Raw transfer]




BB1_A_7(1G27)
DEF_ECOLI
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




MES_B_6(1VEV)
DEF_LEPIN
[Raw transfer]




BB2_C_9(1G2A)
DEF_ECOLI
[Raw transfer]




5LI_P_4(3SW8)
?
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




FMT_A_12(1VEZ)
DEF_LEPIN
[Raw transfer]




FMT_B_18(1VEZ)
DEF_LEPIN
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




FMT_A_3(1XEM)
DEF_ECOLI
[Raw transfer]




FMT_B_11(4DR8)
?
[Raw transfer]




SB7_B_8(2AI8)
DEF_ECOLI
[Raw transfer]




FMT_C_14(4DR8)
?
[Raw transfer]




GOL_A_5(1N5N)
DEF_PSEAE
[Raw transfer]




MES_A_5(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_3(2W3U)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BSZ)
DEF_ECOLI
[Raw transfer]




SB7_A_7(2AI8)
DEF_ECOLI
[Raw transfer]




SB7_C_9(2AI8)
DEF_ECOLI
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




2PE_C_11(1BS4)
DEF_ECOLI
[Raw transfer]




FMT_D_16(4DR8)
?
[Raw transfer]




2PE_C_11(1ICJ)
DEF_ECOLI
[Raw transfer]




FMT_A_5(1XEN)
DEF_ECOLI
[Raw transfer]




2PE_B_10(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




GLY_B_5(1Y6H)
DEF_LEPIN
[Raw transfer]




DTT_B_6(1SV2)
DEF_LEPIN
[Raw transfer]




2PE_B_10(1BS4)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




DTT_A_5(1SV2)
DEF_LEPIN
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




CHAIN_G_4(3G6N)
?
[Raw transfer]

-

CHAIN_D_4(1BS8)
DEF_ECOLI
[Raw transfer]

-

H2S_A_5(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_F_3(3G6N)
?
[Raw transfer]

-

H2S_B_7(4AL2)
DEF_ECOLI
[Raw transfer]




H2S_C_9(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_F_6(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_D_4(1BS6)
DEF_ECOLI
[Raw transfer]

-

BB2_B_6(2OKL)
DEF2_BACCR
[Raw transfer]




CHAIN_E_5(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_F_6(1BS6)
DEF_ECOLI
[Raw transfer]

-

BB2_B_6(2OKL)
DEF2_BACCR
[Raw transfer]




EDO_B_10(4DR8)
?
[Raw transfer]




101 HHSearch 96.4460%-121 - C6 -2OS0 - DEF_ENTFA -
8 PsiBlast_PDB 95.5558%-108 - C6 -1LQW - DEF_STAAU -
4 PsiBlast_PDB 95.4961%-115 - C6 -2OS1 6.3 DEF_ENTFA
24 PsiBlast_CBE 95.4858%-106 - C6 -2AI9 - DEF_STAAU -
104 HHSearch 95.2260%-101 - C6 -2OKL 2.5 DEF2_BACCR
9 PsiBlast_PDB 95.1658%-109 - C6 -2AI9 - DEF_STAAU -
23 PsiBlast_CBE 94.9762%-117 - C6 -3CMD - ? -
22 PsiBlast_CBE 94.7962%-114 - C6 -3G6N 2.7 ?
25 PsiBlast_CBE 94.7558% -99 - C6 -1LQW - DEF_STAAU -
2 PsiBlast_PDB 94.7462%-115 - C6 -3G6N 2.8 ?
5 PsiBlast_PDB 94.0858%-104 - C6 -1LQY 6.6 DEF2_GEOSE
3 PsiBlast_PDB 94.0562%-115 - C6 -3CMD - ? -
10 PsiBlast_PDB 94.0358%-102 - C6 -2OS3 5.8 DEF_STRP1
21 PsiBlast_CBE 93.8261%-102 - C6 -2OKL 6.3 DEF2_BACCR
6 PsiBlast_PDB 93.6860%-116 - C6 -2OS0 - DEF_ENTFA -
14 PsiBlast_PDB 93.5455%-105 - C6 -1LMH - DEF_STAAU -
1 PsiBlast_PDB 93.2761% -99 - C6 -2OKL 6.0 DEF2_BACCR
7 PsiBlast_PDB 91.4757%-108 - C6 -3SW8 5.2 ?
12 PsiBlast_PDB 90.7457%-105 - C6 -2AI7 4.2 DEF_STRR6
13 PsiBlast_PDB 90.4657%-108 - C6 -2AIA 5.6 DEF_STRR6
11 PsiBlast_PDB 90.4157%-106 - C6 -2AIE 4.4 DEF_STRR6
103 HHSearch 77.8533% -84 - C6 -3U04 6.5 ?
107 HHSearch 75.0533% -76 - C6 -1Y6H 3.4 DEF_LEPIN
39 PsiBlast_CBE 74.6231%-101 - C6 -1Y6H 3.4 DEF_LEPIN
43 PsiBlast_CBE 74.3931%-101 - C6 -1VEY 2.7 DEF_LEPIN
46 PsiBlast_CBE 74.1031% -99 - C6 -1SV2 2.4 DEF_LEPIN
38 PsiBlast_CBE 73.8631% -94 - C6 -1Y6H 3.2 DEF_LEPIN
44 PsiBlast_CBE 73.8331% -99 - C6 -1VEV 2.2 DEF_LEPIN
42 PsiBlast_CBE 73.6831% -98 - C6 -1VEY 2.9 DEF_LEPIN
47 PsiBlast_CBE 73.5331% -98 - C6 -1SV2 2.0 DEF_LEPIN
45 PsiBlast_CBE 73.4631% -96 - C6 -1VEV 2.8 DEF_LEPIN
41 PsiBlast_CBE 73.1331% -97 - C6 -1VEZ 3.2 DEF_LEPIN
40 PsiBlast_CBE 72.9231% -96 - C6 -1VEZ 3.2 DEF_LEPIN
127 Fugue 72.6232% -81 - C6 -1G2A 6.1 DEF_ECOLI
31 PsiBlast_CBE 71.9835%-102 - C6 -4DR8 3.3 ?
27 PsiBlast_CBE 71.8235%-104 - C6 -4DR9 6.4 ?
30 PsiBlast_CBE 71.7535%-103 - C6 -4DR8 3.1 ?
17 PsiBlast_PDB 71.5035%-102 - C6 -4DR8 2.8 ?
16 PsiBlast_PDB 71.3735%-107 - C6 -4DR9 6.4 ?
28 PsiBlast_CBE 71.2935%-106 - C6 -4DR9 6.0 ?
29 PsiBlast_CBE 71.1835%-101 - C6 -4DR9 6.5 ?
32 PsiBlast_CBE 70.9735% -98 - C6 -4DR8 3.3 ?
106 HHSearch 70.7234% -77 - C6 -3UWB 6.2 ?
126 Fugue 70.5333% -83 - C6 -1G2A 6.1 DEF_ECOLI
108 HHSearch 70.1431% -73 - C6 -1N5N 2.4 DEF_PSEAE
118 HHSearch 69.2831% -81 - C6 -1RL4 4.1 ?
105 HHSearch 69.0332% -69 - C6 -1XEO 3.6 DEF_ECOLI
110 HHSearch 68.9532% -74 - C6 -2W3T 2.4 DEF_ECOLI
68 PsiBlast_CBE 67.3936%-105 - C6 -1G2A 5.9 DEF_ECOLI
70 PsiBlast_CBE 67.2136%-107 - C6 -1G27 4.7 DEF_ECOLI
52 PsiBlast_CBE 67.1836%-107 - C6 -3K6L 4.5 DEF_ECOLI
50 PsiBlast_CBE 67.1736%-101 - C6 -2W3T 2.4 DEF_ECOLI
36 PsiBlast_CBE 67.0236%-107 - C6 -4AL2 2.8 DEF_ECOLI
37 PsiBlast_CBE 66.9936%-102 - C6 -4AL2 2.8 DEF_ECOLI
63 PsiBlast_CBE 66.8936%-102 - C6 -1ICJ 5.5 DEF_ECOLI
90 PsiBlast_CBE 66.7936%-102 - C6 -1BS4 4.3 DEF_ECOLI
49 PsiBlast_CBE 66.6136% -95 - C6 -2W3U 3.5 DEF_ECOLI
89 PsiBlast_CBE 66.5836%-103 - C6 -1BS4 4.1 DEF_ECOLI
73 PsiBlast_CBE 66.5336%-103 - C6 -1BSZ 5.4 DEF_ECOLI
77 PsiBlast_CBE 66.3536%-102 - C6 -1BS8 3.3 DEF_ECOLI
57 PsiBlast_CBE 66.3236% -99 - C6 -1XEO 3.6 DEF_ECOLI
72 PsiBlast_CBE 66.2636%-101 - C6 -1BSZ 4.4 DEF_ECOLI
35 PsiBlast_CBE 66.2236%-106 - C6 -4AL2 2.8 DEF_ECOLI
74 PsiBlast_CBE 66.1836% -98 - C6 -1BSZ 5.0 DEF_ECOLI
83 PsiBlast_CBE 66.1236%-102 - C6 -1BS6 3.6 DEF_ECOLI
69 PsiBlast_CBE 66.1236%-101 - C6 -1G27 4.8 DEF_ECOLI
59 PsiBlast_CBE 66.1236% -99 - C6 -1XEM 3.6 DEF_ECOLI
58 PsiBlast_CBE 66.0936% -98 - C6 -1XEN 3.0 DEF_ECOLI
85 PsiBlast_CBE 65.9836%-101 - C6 -1BS6 3.6 DEF_ECOLI
84 PsiBlast_CBE 65.8636%-104 - C6 -1BS6 3.8 DEF_ECOLI
67 PsiBlast_CBE 65.8536% -99 - C6 -1G2A 6.3 DEF_ECOLI
65 PsiBlast_CBE 65.8236% -98 - C6 -1ICJ 4.4 DEF_ECOLI
60 PsiBlast_CBE 65.6536%-105 - C6 -1LRU 6.1 DEF_ECOLI
56 PsiBlast_CBE 65.5636% -97 - C6 -2AI8 4.2 DEF_ECOLI
54 PsiBlast_CBE 65.5036%-102 - C6 -2AI8 4.0 DEF_ECOLI
91 PsiBlast_CBE 65.4936%-100 - C6 -1BS4 5.2 DEF_ECOLI
79 PsiBlast_CBE 65.3736% -99 - C6 -1BS8 3.9 DEF_ECOLI
53 PsiBlast_CBE 65.2236%-101 - C6 -3K6L 5.3 DEF_ECOLI
62 PsiBlast_CBE 65.0636% -97 - C6 -1LRU 6.3 DEF_ECOLI
71 PsiBlast_CBE 65.0536%-108 - C6 -1G27 5.4 DEF_ECOLI
34 PsiBlast_CBE 64.9735%-102 - C6 -3U04 6.7 ?
55 PsiBlast_CBE 64.7736% -97 - C6 -2AI8 3.9 DEF_ECOLI
66 PsiBlast_CBE 64.7636% -99 - C6 -1G2A 6.6 DEF_ECOLI
61 PsiBlast_CBE 63.7936% -99 - C6 -1LRU 6.8 DEF_ECOLI
19 PsiBlast_PDB 61.1638% -98 - C6 -3UWB 6.3 ?