Study : Lmo1063 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: ADP_A_5(2Q0H) / Model_41(2Q0H/A) = [3.6] Download254.5014.64METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGAGKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQNVYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAPFIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI
Complex: AGS_B_6(3C4J) / Model_38(3C4J/B) = [3.7] Download776.6414.43METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGAGKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQNVYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAPFIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI
Complex: ADP_B_6(2OLJ) / Model_50(2OLJ/B) = [3.9] Download686.8910.85METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGAGKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQNVYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAPFIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI
Complex: AT4_A_5(2OLK) / Model_49(2OLK/A) = [4.3] Download390.157.86METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGAGKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQNVYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAPFIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI
Complex: ANP_K_6(3C41) / Model_37(3C41/K) = [4.3] Download791.4111.69METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGAGKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQNVYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAPFIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI
Consensus
[pKd Mean = 3.96]
-579
(s=217)
11
(s=2)
METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGAGKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQNVYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAPFIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI