@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1063: (2016-03-21 )
METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGAGKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQNVYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAPFIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_J_5(3C41)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ADP_A_3(1F3O)
Y796_METJA
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




2 PsiBlast_PDB 95.8040%-102 - C1 -1F3O 5.4 Y796_METJA
21 PsiBlast_CBE 95.0540%-104 - C1 -1L2T 7.1 Y796_METJA
1 PsiBlast_PDB 94.3940%-102 - C1 -1L2T - Y796_METJA -
22 PsiBlast_CBE 93.4539%-108 - C1 -3TIF 6.9 Y796_METJA
91 HHSearch 93.1740% -95 - C1 -3TIF - Y796_METJA -
3 PsiBlast_PDB 90.6639%-101 - C1 -3TIF 6.1 Y796_METJA
90 HHSearch 84.8036% -94 - C1 -2PCJ - LOLD_AQUAE -
67 Fugue 83.6532%-102 * C1 *3TUZ - METN_ECOLI -
63 PsiBlast_CBE 82.3232%-109 - C1 -1B0U - HISP_SALTY -
94 HHSearch 81.4132%-105 - C1 -1B0U - HISP_SALTY -
32 PsiBlast_CBE 79.6233%-100 - C1 -3TUI - METN_ECOLI -
68 Fugue 78.8130% -92 - C1 -1Z47 - ? -
29 PsiBlast_CBE 78.5833%-103 - C1 -3TUZ - METN_ECOLI -
16 PsiBlast_PDB 78.5133%-101 - C1 -3TUZ - METN_ECOLI -
4 PsiBlast_PDB 78.2139% -92 - C1 -2PCJ - LOLD_AQUAE -
5 PsiBlast_PDB 77.1539% -90 - C1 -2PCL - LOLD_AQUAE -
75 HHSearch 76.9431% -89 - C1 -3TUI - METN_ECOLI -
30 PsiBlast_CBE 76.7333%-102 - C1 -3TUZ - METN_ECOLI -
33 PsiBlast_CBE 76.7133% -98 - C1 -3TUI - METN_ECOLI -
31 PsiBlast_CBE 76.4633% -96 - C1 -3TUZ - METN_ECOLI -
51 PsiBlast_CBE 74.6333%-105 - C1 -2OLJ 4.6 ?
46 PsiBlast_CBE 72.6133% -97 - C1 -2OLK 4.4 ?
38 PsiBlast_CBE 72.4133%-102 - C1 -3C4J 3.7 ?
28 PsiBlast_CBE 72.3635%-107 - C1 -4YMU 4.4 ?
37 PsiBlast_CBE 72.2933% -95 - C1 -3C41 4.3 ?
7 PsiBlast_PDB 72.2233% -92 - C1 -4U00 4.6 ?
48 PsiBlast_CBE 71.6233%-100 - C1 -2OLK 4.4 ?
47 PsiBlast_CBE 71.5133% -94 - C1 -2OLK 4.6 ?
39 PsiBlast_CBE 71.3433% -98 - C1 -3C4J 5.3 ?
27 PsiBlast_CBE 71.3435%-105 - C1 -4YMV 4.4 ?
41 PsiBlast_CBE 71.0633% -96 - C1 -2Q0H 3.6 ?
20 PsiBlast_PDB 71.0333% -93 - C1 -3C41 5.2 ?
49 PsiBlast_CBE 70.9433% -95 - C1 -2OLK 4.3 ?
12 PsiBlast_PDB 70.4735%-107 - C1 -4YMV 4.3 ?
11 PsiBlast_PDB 70.1535%-104 - C1 -4YMU 5.0 ?
50 PsiBlast_CBE 69.4933% -93 - C1 -2OLJ 3.9 ?
40 PsiBlast_CBE 68.8833% -95 - C1 -2Q0H 4.5 ?