@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1081: (2016-03-21 )
MKGIILAGGSGTRLYPLTKAISKQMLPIYDKPMIYYPLSILMLAGIKDILIISTPEDTPRFEQLLADSDQLGINISYAVQEKPEGLAQAFIIAEDFIGDDSVSLILGDNIYYGQGLSKMLQRASAKKAGATVFGYHVNDPERFGVVEFDESMKAISIEEKPTEPKSNYAVTGLYFYDNRVVEIAKSIKPSERGELEITDVNKRYLELGELDVELMGRGFAWLDTGTHESLLEASTFIETIERRQNLKIACLEEIAYRMGYIDEAAVEKLAEPLKKNAYGQYLMKLINK

Atome Classification :

(89 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

N5Y_B_8(4ASY)
?
[Raw transfer]




N6A_A_5(4ASJ)
?
[Raw transfer]




Y46_C_9(3ZLK)
?
[Raw transfer]




Y46_A_5(3ZLK)
?
[Raw transfer]




N6A_C_10(4ASJ)
?
[Raw transfer]




HNR_B_8(4ARW)
?
[Raw transfer]




HNR_C_12(4ARW)
?
[Raw transfer]




N5Y_C_11(4ASY)
?
[Raw transfer]




Y46_D_11(3ZLK)
?
[Raw transfer]




N6A_B_8(4ASJ)
?
[Raw transfer]




BBE_D_11(4B5B)
?
[Raw transfer]




N5Y_D_14(4ASY)
?
[Raw transfer]




TRH_O_15(1G3L)
?
[Raw transfer]




BBE_B_7(4B5B)
?
[Raw transfer]




Y46_B_7(3ZLK)
?
[Raw transfer]




BBE_C_9(4B5B)
?
[Raw transfer]




KKT_C_10(4B4G)
?
[Raw transfer]




N6A_D_13(4ASJ)
?
[Raw transfer]




JWT_C_11(4B4M)
?
[Raw transfer]




JWT_A_5(4B4M)
?
[Raw transfer]




TTP_A_3(4HO3)
?
[Raw transfer]




UTP_B_11(4HO9)
?
[Raw transfer]




BBE_A_5(4B5B)
?
[Raw transfer]




N5Y_A_5(4ASY)
?
[Raw transfer]




DAU_B_9(4HO5)
?
[Raw transfer]




942_B_8(4B42)
?
[Raw transfer]




942_D_14(4B42)
?
[Raw transfer]




DAU_A_4(4HO5)
?
[Raw transfer]




KKT_B_7(4B4G)
?
[Raw transfer]




942_C_11(4B42)
?
[Raw transfer]




HNR_D_16(4ARW)
?
[Raw transfer]




942_A_5(4B42)
?
[Raw transfer]




UTP_A_3(4HO6)
?
[Raw transfer]




GOL_A_8(3ZLL)
?
[Raw transfer]




HNR_A_5(4ARW)
?
[Raw transfer]




TYD_A_13(1LVW)
?
[Raw transfer]




JWT_D_14(4B4M)
?
[Raw transfer]




KKT_D_13(4B4G)
?
[Raw transfer]




UTP_A_4(4HO9)
?
[Raw transfer]




THM_B_9(4HO4)
?
[Raw transfer]




THM_D_20(1H5R)
RMLA1_ECOLI
[Raw transfer]




THM_B_11(4HO8)
?
[Raw transfer]




THM_D_23(4HO8)
?
[Raw transfer]




TTP_G_7(1IIM)
RMLA_SALTY
[Raw transfer]




TYD_D_12(1H5T)
RMLA1_ECOLI
[Raw transfer]




KKT_A_5(4B4G)
?
[Raw transfer]




THM_A_6(4HO8)
?
[Raw transfer]




TYD_A_6(1H5T)
RMLA1_ECOLI
[Raw transfer]




THM_A_3(4HO2)
?
[Raw transfer]




THM_C_18(1H5R)
RMLA1_ECOLI
[Raw transfer]




THM_A_5(4HO4)
?
[Raw transfer]




TMP_A_5(1H5S)
RMLA1_ECOLI
[Raw transfer]




TMP_D_11(1H5S)
RMLA1_ECOLI
[Raw transfer]




TYD_B_8(1H5T)
RMLA1_ECOLI
[Raw transfer]




TTP_K_11(1IIM)
RMLA_SALTY
[Raw transfer]




TTP_K_11(1IIM)
RMLA_SALTY
[Raw transfer]




TMP_B_7(1H5S)
RMLA1_ECOLI
[Raw transfer]




TRH_M_13(1G3L)
?
[Raw transfer]




THM_A_14(1H5R)
RMLA1_ECOLI
[Raw transfer]




TRH_Q_17(1G3L)
?
[Raw transfer]




NIQ_B_7(4B2X)
?
[Raw transfer]




BZ0_C_11(4B2W)
?
[Raw transfer]




GOL_B_12(3ZLL)
?
[Raw transfer]




THM_C_17(4HO8)
?
[Raw transfer]




JWT_B_8(4B4M)
?
[Raw transfer]




TMP_C_9(1H5S)
RMLA1_ECOLI
[Raw transfer]




BZ0_A_5(4B2W)
?
[Raw transfer]




THM_B_16(1H5R)
RMLA1_ECOLI
[Raw transfer]




BZ0_B_8(4B2W)
?
[Raw transfer]




TYD_C_10(1H5T)
RMLA1_ECOLI
[Raw transfer]




BZ0_D_14(4B2W)
?
[Raw transfer]




NIQ_C_9(4B2X)
?
[Raw transfer]




NIQ_D_11(4B2X)
?
[Raw transfer]




GJB_D_14(4B4B)
?
[Raw transfer]




GJB_B_8(4B4B)
?
[Raw transfer]




NIQ_A_5(4B2X)
?
[Raw transfer]




GJB_A_5(4B4B)
?
[Raw transfer]




GJB_C_11(4B4B)
?
[Raw transfer]




4WF_D_17(3ZLL)
?
[Raw transfer]




NWL_A_5(4B3U)
?
[Raw transfer]




NWL_C_12(4B3U)
?
[Raw transfer]




NWL_B_9(4B3U)
?
[Raw transfer]




4WF_A_5(3ZLL)
?
[Raw transfer]




NWL_D_17(4B3U)
?
[Raw transfer]




4WF_B_10(3ZLL)
?
[Raw transfer]




4WF_C_14(3ZLL)
?
[Raw transfer]




26 PsiBlast_CBE 95.9577%-131 - C1 -4HO5 5.3 ?
8 PsiBlast_PDB 95.8377%-127 - C1 -4HO9 4.5 ?
22 PsiBlast_CBE 95.2877%-129 - C1 -4HO9 5.3 ?
27 PsiBlast_CBE 95.2177%-131 - C1 -4HO4 4.0 ?
2 PsiBlast_PDB 95.1477%-130 - C1 -4HO2 4.1 ?
9 PsiBlast_PDB 95.1177%-128 - C1 -4HOC - ? -
21 PsiBlast_CBE 95.0477%-127 - C1 -4HOC - ? -
3 PsiBlast_PDB 95.0177%-131 - C1 -4HO3 5.4 ?
1 PsiBlast_PDB 94.7277%-130 - C1 -4HO0 - ? -
6 PsiBlast_PDB 94.5877%-128 - C1 -4HO6 5.0 ?
4 PsiBlast_PDB 94.5277%-126 - C1 -4HO4 4.0 ?
50 PsiBlast_CBE 93.6768%-133 - C1 -4B4G 5.1 ?
5 PsiBlast_PDB 93.5277%-124 - C1 -4HO5 5.6 ?
23 PsiBlast_CBE 93.3477%-126 - C1 -4HO8 4.0 ?
65 PsiBlast_CBE 93.2868%-131 - C1 -4B2W 5.2 ?
76 PsiBlast_CBE 93.2768%-132 - C1 -4ARW 5.0 ?
24 PsiBlast_CBE 93.2077%-128 - C1 -4HO8 3.7 ?
25 PsiBlast_CBE 93.1577%-128 - C1 -4HO8 3.9 ?
38 PsiBlast_CBE 92.8268%-128 - C1 -1IIN - RMLA_SALTY -
87 PsiBlast_CBE 92.6768%-131 - C1 -3PKP - RMLA_SALTY -
7 PsiBlast_PDB 92.6777%-127 - C1 -4HO8 4.0 ?
19 PsiBlast_PDB 92.4068%-129 - C1 -4B4G 4.8 ?
42 PsiBlast_CBE 92.1168%-127 - C1 -4B5B 6.2 ?
72 PsiBlast_CBE 92.0368%-131 - C1 -3ZLK 5.8 ?
102 HHSearch 92.0065%-133 - C1 -1LVW 5.5 ?
43 PsiBlast_CBE 91.9768%-127 - C1 -4B5B 5.4 ?
51 PsiBlast_CBE 91.9268%-125 - C1 -4B4B 3.6 ?
104 HHSearch 91.7868%-127 - C1 -1IIM 3.9 RMLA_SALTY
48 PsiBlast_CBE 91.7468%-127 - C1 -4B4G 4.4 ?
46 PsiBlast_CBE 91.6368%-128 - C1 -4B4M 6.2 ?
78 PsiBlast_CBE 91.6268%-127 - C1 -4ARW 5.0 ?
62 PsiBlast_CBE 91.5568%-126 - C1 -4B2X 4.2 ?
15 PsiBlast_PDB 91.5568%-127 - C1 -4B2X 4.6 ?
35 PsiBlast_CBE 91.4571%-125 - C1 -1H5R 4.2 RMLA1_ECOLI
53 PsiBlast_CBE 91.3968%-128 - C1 -4B4B 3.7 ?
13 PsiBlast_PDB 91.3768%-127 - C1 -1IIM 3.9 RMLA_SALTY
66 PsiBlast_CBE 91.3568%-126 - C1 -4B2W 5.3 ?
18 PsiBlast_PDB 91.3368%-127 - C1 -4B4B 3.8 ?
64 PsiBlast_CBE 91.2468%-131 - C1 -4B2W 5.4 ?
33 PsiBlast_CBE 91.1971%-124 - C1 -1H5T 4.4 RMLA1_ECOLI
69 PsiBlast_CBE 91.1868%-127 - C1 -3ZLL 3.6 ?
56 PsiBlast_CBE 91.1868%-128 - C1 -4B42 5.2 ?
63 PsiBlast_CBE 91.1768%-129 - C1 -4B2W 5.5 ?
44 PsiBlast_CBE 91.1668%-126 - C1 -4B5B 6.3 ?
75 PsiBlast_CBE 91.1268%-126 - C1 -4ARW 4.7 ?
54 PsiBlast_CBE 91.1268%-127 - C1 -4B42 4.5 ?
52 PsiBlast_CBE 91.0968%-126 - C1 -4B4B 3.7 ?
47 PsiBlast_CBE 91.0268%-126 - C1 -4B4M 5.4 ?
16 PsiBlast_PDB 91.0068%-126 - C1 -4B3U 4.6 ?
70 PsiBlast_CBE 90.9868%-125 - C1 -3ZLL 3.6 ?
98 PsiBlast_CBE 90.9668%-127 - C1 -4ASJ 5.5 ?
61 PsiBlast_CBE 90.9468%-128 - C1 -4B2X 4.1 ?
32 PsiBlast_CBE 90.8371%-121 - C1 -1H5R 3.9 RMLA1_ECOLI
45 PsiBlast_CBE 90.7668%-125 - C1 -4B4M 5.9 ?
77 PsiBlast_CBE 90.5768%-126 - C1 -4ARW 5.0 ?
91 PsiBlast_CBE 90.5568%-125 - C1 -4ASY 5.6 ?
96 PsiBlast_CBE 90.5168%-125 - C1 -4ASJ 5.6 ?
68 PsiBlast_CBE 90.5168%-126 - C1 -3ZLL 3.4 ?
74 PsiBlast_CBE 90.5068%-127 - C1 -3ZLK 6.2 ?
34 PsiBlast_CBE 90.5071%-126 - C1 -1H5S 4.1 RMLA1_ECOLI
20 PsiBlast_PDB 90.5068%-127 - C1 -4B4M 5.8 ?
41 PsiBlast_CBE 90.3868%-124 - C1 -4B5B 6.2 ?
58 PsiBlast_CBE 90.3768%-126 - C1 -4B3U 4.1 ?
36 PsiBlast_CBE 90.3471%-127 - C1 -1H5S 4.1 RMLA1_ECOLI
11 PsiBlast_PDB 90.2271%-125 - C1 -1H5T 4.0 RMLA1_ECOLI
55 PsiBlast_CBE 90.2168%-128 - C1 -4B42 4.6 ?
71 PsiBlast_CBE 90.2068%-126 - C1 -3ZLK 6.0 ?
60 PsiBlast_CBE 90.1968%-124 - C1 -4B2X 4.5 ?
57 PsiBlast_CBE 90.0968%-123 - C1 -4B3U 4.5 ?
92 PsiBlast_CBE 90.0868%-125 - C1 -4ASY 5.7 ?
67 PsiBlast_CBE 90.0768%-124 - C1 -3ZLL 3.3 ?
99 PsiBlast_CBE 89.9968%-127 - C1 -1G3L 5.6 ?
17 PsiBlast_PDB 89.9968%-127 - C1 -4B42 4.8 ?
59 PsiBlast_CBE 89.9868%-124 - C1 -4B3U 4.7 ?
100 PsiBlast_CBE 89.9568%-126 - C1 -1G3L 5.3 ?
101 PsiBlast_CBE 89.9168%-127 - C1 -1G3L 5.2 ?
10 PsiBlast_PDB 89.8971%-124 - C1 -1H5S 4.0 RMLA1_ECOLI
12 PsiBlast_PDB 89.8771%-123 - C1 -1H5R 3.9 RMLA1_ECOLI
73 PsiBlast_CBE 89.8668%-125 - C1 -3ZLK 5.9 ?
97 PsiBlast_CBE 89.6268%-124 - C1 -4ASJ 5.7 ?
31 PsiBlast_CBE 89.6271%-124 - C1 -1H5R 3.6 RMLA1_ECOLI
28 PsiBlast_CBE 89.5271%-121 - C1 -1H5T 4.1 RMLA1_ECOLI
40 PsiBlast_CBE 89.4968%-125 - C1 -1IIM 4.2 RMLA_SALTY
93 PsiBlast_CBE 89.2668%-124 - C1 -4ASY 5.7 ?
30 PsiBlast_CBE 89.2671%-123 - C1 -1H5S 4.1 RMLA1_ECOLI
95 PsiBlast_CBE 89.0968%-123 - C1 -4ASJ 6.1 ?
49 PsiBlast_CBE 88.8568%-126 - C1 -4B4G 5.2 ?
29 PsiBlast_CBE 88.5971%-123 - C1 -1H5T 4.1 RMLA1_ECOLI
94 PsiBlast_CBE 87.9368%-125 - C1 -4ASY 5.7 ?