@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1083: (2016-03-21 )
MNLLVTGGAGFIGSNFVHHILNKHDDYKVVNLDLLTYAGTMSNLEDIKENPNHVFVEGNICDYDLVKKLVTDHKIDTIVNFAAESHVDRSIINPGIFIETNVQGTLNLLNVAKELNVAKYLQVSTDEVYGSLGETGYFTEETPIAPNSPYSASKASADLLVRSYFETYGLNVNITRCSNNYGPHHFPEKLIPLMITNGLDGENLPIYGDGKNIRDWLHVSDHCAAIDLVIHNGKSGEVYNVGGHNERTNNEIVHIIVDDLNLSKDKIVYVEDRLGHDLRYAIDPKKIETELGWEPKYTFDTGIKETIEWYVNNEAWWRPLKSRAKLGE

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_2(1R6D)
?
[Raw transfer]




NAD_H_8(1KER)
?
[Raw transfer]




NAD_A_2(1R6D)
?
[Raw transfer]




DAU_C_3(1KEU)
RMLB_SALTY
[Raw transfer]




NAD_F_6(1KEU)
RMLB_SALTY
[Raw transfer]




NAD_E_5(1KEU)
RMLB_SALTY
[Raw transfer]




NAD_F_6(1KEW)
RMLB_SALTY
[Raw transfer]




NAD_A_3(1R66)
?
[Raw transfer]




NAD_C_3(2HUN)
?
[Raw transfer]




NAD_E_5(1KEW)
RMLB_SALTY
[Raw transfer]




DAU_D_4(1KEU)
RMLB_SALTY
[Raw transfer]




NAD_C_3(2HUN)
?
[Raw transfer]




NAD_E_5(1KEW)
RMLB_SALTY
[Raw transfer]




NAD_A_4(1OC2)
?
[Raw transfer]




NAD_D_4(2HUN)
?
[Raw transfer]




NAD_G_7(1KEP)
RMLB_STRMU
[Raw transfer]




NAD_A_4(1OC2)
?
[Raw transfer]




NAD_F_6(1KEP)
RMLB_STRMU
[Raw transfer]




NAD_B_8(1OC2)
?
[Raw transfer]




NAD_E_5(1KET)
RMLB_STRMU
[Raw transfer]




NAD_F_6(1KET)
RMLB_STRMU
[Raw transfer]




NAD_A_3(1BXK)
RMLB2_ECOLI
[Raw transfer]




NAD_B_4(1BXK)
RMLB2_ECOLI
[Raw transfer]




NAD_I_9(1KER)
?
[Raw transfer]




1 PsiBlast_PDB 95.1759% -86 - C1 -4EGB - ? -
45 HHSearch 90.0652% -88 - C1 -1R6D 11.1 ?
3 PsiBlast_PDB 89.0651% -84 - C1 -1R66 11.2 ?
4 PsiBlast_PDB 89.0151% -85 - C1 -1R6D 11.1 ?
2 PsiBlast_PDB 87.9253% -91 - C1 -2HUN 9.0 ?
48 HHSearch 87.3852% -89 - C1 -2HUN 9.0 ?
53 HHSearch 86.9547% -80 * C1 *1OC2 9.8 ?
26 PsiBlast_CBE 86.7349% -79 - C1 -1G1A - RMLB_SALTY -
21 PsiBlast_CBE 86.7353% -88 - C1 -2HUN 10.1 ?
49 HHSearch 86.3753% -83 - C1 -1KEW 10.5 RMLB_SALTY
25 PsiBlast_CBE 85.6249% -80 - C1 -1G1A - RMLB_SALTY -
30 PsiBlast_CBE 85.1946% -80 - C1 -1KER 9.8 ?
27 PsiBlast_CBE 84.5149% -79 - C1 -1G1A - RMLB_SALTY -
28 PsiBlast_CBE 84.4146% -78 - C1 -1OC2 9.6 ?
12 PsiBlast_PDB 84.0946% -77 - C1 -1OC2 9.8 ?
23 PsiBlast_CBE 84.0249% -79 - C1 -1KEW 10.1 RMLB_SALTY
8 PsiBlast_PDB 84.0149% -79 - C1 -1KEW 10.5 RMLB_SALTY
6 PsiBlast_PDB 83.4749% -79 - C1 -1G1A - RMLB_SALTY -
24 PsiBlast_CBE 82.9349% -77 - C1 -1KEU 9.8 RMLB_SALTY
29 PsiBlast_CBE 82.2846% -78 - C1 -1KET 10.0 RMLB_STRMU
7 PsiBlast_PDB 82.2449% -76 - C1 -1KEU 9.8 RMLB_SALTY
31 PsiBlast_CBE 82.0646% -77 - C1 -1KEP 10.0 RMLB_STRMU
5 PsiBlast_PDB 82.0148% -75 - C1 -1BXK 10.8 RMLB2_ECOLI
9 PsiBlast_PDB 81.9046% -78 - C1 -1KEP 10.7 RMLB_STRMU
10 PsiBlast_PDB 81.7546% -76 - C1 -1KER 9.9 ?
11 PsiBlast_PDB 81.3046% -78 - C1 -1KET 10.2 RMLB_STRMU
22 PsiBlast_CBE 80.0448% -72 - C1 -1BXK 10.4 RMLB2_ECOLI