@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1093: (2016-03-21 )
MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVLGISGGQDSTLTGKLAQMAISEMRAETGDDEYRFFAVSLPYGTQLDESDRQDALNFMEPDNRLTVNIKASVDASVAALAEAGVELSDFAKGNEKARERMKVQYAIAAMHKGVVVGTDHSAEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALPDEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADJ_B_19(1KQP)
NADE_BACSU
[Raw transfer]




NAD_B_10(2NSY)
NADE_BACSU
[Raw transfer]




DND_C_3(1IFX)
NADE_BACSU
[Raw transfer]




NAD_A_8(2NSY)
NADE_BACSU
[Raw transfer]




NAD_A_8(2NSY)
NADE_BACSU
[Raw transfer]




DND_A_4(1EE1)
NADE_BACSU
[Raw transfer]




ATP_A_6(1NSY)
NADE_BACSU
[Raw transfer]




ATP_B_5(1NSY)
NADE_BACSU
[Raw transfer]




DND_B_5(1EE1)
NADE_BACSU
[Raw transfer]




APC_A_5(2PZ8)
NADE_BACAN
[Raw transfer]




APC_A_6(1IH8)
NADE_BACSU
[Raw transfer]




DND_D_4(1IFX)
NADE_BACSU
[Raw transfer]




NAD_B_2(1WXH)
NADE_ECOLI
[Raw transfer]




ATP_A_6(1EE1)
NADE_BACSU
[Raw transfer]




APC_B_6(2PZ8)
NADE_BACAN
[Raw transfer]




AMP_A_4(1WXI)
NADE_ECOLI
[Raw transfer]




AMP_A_5(1WXI)
NADE_ECOLI
[Raw transfer]




AMP_A_5(1WXI)
NADE_ECOLI
[Raw transfer]




AMP_A_8(2PZA)
NADE_BACAN
[Raw transfer]




AMP_D_22(3FIU)
?
[Raw transfer]




AMP_C_17(3FIU)
?
[Raw transfer]




AMP_A_4(1FYD)
NADE_BACSU
[Raw transfer]




AMP_B_7(2PZA)
NADE_BACAN
[Raw transfer]




AMP_A_7(3FIU)
?
[Raw transfer]




AMP_B_12(3FIU)
?
[Raw transfer]




AMP_A_7(3FIU)
?
[Raw transfer]




5 PsiBlast_PDB 96.6268% -63 - C4 -1WXI 4.4 NADE_ECOLI
2 PsiBlast_PDB 96.5068% -71 - C4 -1WXF - NADE_ECOLI -
4 PsiBlast_PDB 95.6668% -71 - C4 -1WXH 6.8 NADE_ECOLI
37 HHSearch 95.4168% -61 - C4 -1WXI 4.4 NADE_ECOLI
6 PsiBlast_PDB 95.2967% -65 - C4 -3HMQ - NADE_SALTY -
1 PsiBlast_PDB 95.2868% -69 - C4 -1WXE - NADE_ECOLI -
3 PsiBlast_PDB 95.1068% -69 - C4 -1WXG - NADE_ECOLI -
15 PsiBlast_PDB 90.8154% -53 - C4 -4Q16 - NADE_DEIRA -
28 PsiBlast_CBE 90.7855% -48 - C4 -2PZA 4.0 NADE_BACAN
29 PsiBlast_CBE 89.5655% -49 - C4 -2PZ8 6.9 NADE_BACAN
32 PsiBlast_CBE 88.9954% -56 - C4 -4Q16 - NADE_DEIRA -
14 PsiBlast_PDB 88.9355% -44 - C4 -2PZA 4.3 NADE_BACAN
16 PsiBlast_PDB 88.9050% -59 - C4 -3Q4G - NADE_VIBCH -
13 PsiBlast_PDB 88.8655% -47 - C4 -2PZ8 7.0 NADE_BACAN
8 PsiBlast_PDB 88.6555% -49 - C4 -2NSY 7.0 NADE_BACSU
30 PsiBlast_CBE 88.5154% -53 - C4 -4Q16 - NADE_DEIRA -
21 PsiBlast_CBE 88.4855% -47 - C4 -2NSY 6.0 NADE_BACSU
10 PsiBlast_PDB 88.4455% -52 - C4 -1FYD 4.9 NADE_BACSU
27 PsiBlast_CBE 88.3255% -67 - C4 -2PZB - NADE_BACAN -
23 PsiBlast_CBE 87.9655% -47 - C4 -1KQP 8.9 NADE_BACSU
7 PsiBlast_PDB 87.9455% -50 - C4 -1NSY 4.0 NADE_BACSU
22 PsiBlast_CBE 87.8455% -51 - C4 -1NSY 3.8 NADE_BACSU
12 PsiBlast_PDB 87.6455% -48 - C4 -1IH8 6.3 NADE_BACSU
9 PsiBlast_PDB 87.4855% -48 - C4 -1EE1 6.9 NADE_BACSU
58 Fugue 87.4055% -46 - C4 -2NSY 7.0 NADE_BACSU
25 PsiBlast_CBE 87.1755% -71 - C4 -1IFX 6.1 NADE_BACSU
26 PsiBlast_CBE 86.1355% -66 - C4 -1EE1 5.8 NADE_BACSU
11 PsiBlast_PDB 84.9055% -65 - C4 -1IFX 6.1 NADE_BACSU
33 PsiBlast_CBE 71.3334% -32 - C4 -3FIU 4.4 ?
34 PsiBlast_CBE 71.3034% -32 - C4 -3FIU 4.7 ?
19 PsiBlast_PDB 71.1234% -30 - C4 -3FIU 4.2 ?
35 PsiBlast_CBE 70.7434% -30 - C4 -3FIU 4.5 ?
39 HHSearch 67.2434% -29 * C4 *3FIU 4.5 ?