@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1151: (2016-03-22 )
MQEALGLVETKGLVGAIEAADAMVKSANVTLTGYEKIGSGLVTVMVRGDVGAVKAATEAGAAAAKNVGTVMSTHVIPRPHTDVEEILPVRVKSDE

Atome Classification :

(56 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TAR_D_22(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




PGO_C_20(4QIF)
PDUA_SALTY
[Raw transfer]




PGO_A_10(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_G_20(4P2S)
?
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_D_17(4P2S)
?
[Raw transfer]




GOL_G_20(4P2S)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_G_19(4P2S)
?
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_D_17(4P2S)
?
[Raw transfer]




GOL_C_8(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_A_9(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_C_8(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_6(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_A_6(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_22(4QIF)
PDUA_SALTY
[Raw transfer]




29 PsiBlast_CBE 94.2583% -96 - C5 -4P2S 2.7 ?
33 PsiBlast_CBE 93.5083% -99 - C5 -4P2S 3.0 ?
30 PsiBlast_CBE 93.1583% -98 - C5 -4P2S 2.7 ?
26 PsiBlast_CBE 92.9883% -95 - C5 -4P2S 2.7 ?
55 PsiBlast_CBE 92.5882% -98 - C5 -4QIG - PDUA_SALTY -
63 PsiBlast_CBE 92.1182% -96 - C5 -4QIF 2.8 PDUA_SALTY
48 PsiBlast_CBE 91.9682%-100 - C5 -4RBU - PDUA_SALTY -
37 PsiBlast_CBE 91.8383% -96 - C5 -4PPD - PDUA_SALTY -
54 PsiBlast_CBE 91.8282% -97 - C5 -4RBU - PDUA_SALTY -
1 PsiBlast_PDB 91.7185% -94 - C5 -3NGK - PDUA_SALTY -
60 PsiBlast_CBE 91.6282% -91 - C5 -4QIF 3.0 PDUA_SALTY
22 PsiBlast_CBE 91.6183% -93 - C5 -4P7V 2.9 ?
41 PsiBlast_CBE 91.4883% -89 - C5 -4QIE Error PDUA_SALTY
66 PsiBlast_CBE 91.4180% -97 - C5 -4RBV - PDUA_SALTY -
4 PsiBlast_PDB 90.8683% -98 - C5 -4P2S 2.8 ?
32 PsiBlast_CBE 90.8583% -94 - C5 -4P2S 2.8 ?
8 PsiBlast_PDB 90.8082% -91 - C5 -4QIG - PDUA_SALTY -
51 PsiBlast_CBE 90.7482% -95 - C5 -4RBU - PDUA_SALTY -
34 PsiBlast_CBE 90.7083% -98 - C5 -4PPD 2.7 PDUA_SALTY
31 PsiBlast_CBE 90.4683% -98 - C5 -4P2S 3.2 ?
35 PsiBlast_CBE 90.3783% -99 - C5 -4PPD 2.7 PDUA_SALTY
46 PsiBlast_CBE 90.1583% -87 - C5 -4QIE 2.7 PDUA_SALTY
58 PsiBlast_CBE 90.0582% -87 - C5 -4QIF 2.8 PDUA_SALTY
44 PsiBlast_CBE 89.9783% -93 - C5 -4QIE 2.7 PDUA_SALTY
27 PsiBlast_CBE 89.7683% -94 - C5 -4P2S 2.8 ?
25 PsiBlast_CBE 89.5983% -90 - C5 -4P7V 2.9 ?
21 PsiBlast_CBE 89.4683% -88 - C5 -4P7V 2.7 ?
40 PsiBlast_CBE 89.4183% -92 - C5 -4QIE 2.8 PDUA_SALTY
43 PsiBlast_CBE 89.2083% -82 - C5 -4QIE 2.7 PDUA_SALTY
45 PsiBlast_CBE 88.8883% -87 - C5 -4QIE 2.6 PDUA_SALTY
3 PsiBlast_PDB 88.7783% -95 - C5 -4P7V 2.9 ?
62 PsiBlast_CBE 88.1882% -89 - C5 -4QIF 2.8 PDUA_SALTY
6 PsiBlast_PDB 88.1183% -90 - C5 -4QIE 2.7 PDUA_SALTY
61 PsiBlast_CBE 88.0782% -93 - C5 -4QIF 2.7 PDUA_SALTY
23 PsiBlast_CBE 88.0483% -92 - C5 -4P7V 2.8 ?
64 PsiBlast_CBE 87.8082% -92 - C5 -4QIF 2.8 PDUA_SALTY
24 PsiBlast_CBE 87.5983% -90 - C5 -4P7V 2.7 ?
5 PsiBlast_PDB 87.4283% -94 - C5 -4PPD 2.8 PDUA_SALTY
28 PsiBlast_CBE 87.4183% -89 - C5 -4P2S 3.2 ?
47 PsiBlast_CBE 87.3583% -91 - C5 -4QIE 2.7 PDUA_SALTY
59 PsiBlast_CBE 86.8382% -90 - C5 -4QIF 2.8 PDUA_SALTY
9 PsiBlast_PDB 85.9582% -85 - C5 -4QIF 2.9 PDUA_SALTY
57 PsiBlast_CBE 84.3682% -89 - C5 -4QIF 2.7 PDUA_SALTY
91 PsiBlast_CBE 83.4657%-103 - C5 -3CIM 2.8 CCMK2_SYNY3
42 PsiBlast_CBE 83.0283% -82 - C5 -4QIE 2.8 PDUA_SALTY
36 PsiBlast_CBE 82.7983% -86 - C5 -4PPD 2.8 PDUA_SALTY
20 PsiBlast_PDB 81.6257% -92 - C5 -3CIM 2.7 CCMK2_SYNY3
90 PsiBlast_CBE 81.5257% -95 - C5 -3CIM 2.8 CCMK2_SYNY3
69 PsiBlast_CBE 81.0758% -82 - C5 -3SSQ 2.7 ?
70 PsiBlast_CBE 80.4758% -84 - C5 -3SSQ 2.9 ?
108 HHSearch 79.9259% -81 - C5 -3SSQ 2.7 ?
14 PsiBlast_PDB 79.3858% -82 - C5 -3SSQ 2.7 ?
73 PsiBlast_CBE 78.9458% -85 - C5 -3SSQ 3.0 ?
72 PsiBlast_CBE 78.5158% -84 - C5 -3SSQ 2.7 ?
101 HHSearch 77.4957% -83 - C5 -3CIM 2.7 CCMK2_SYNY3
71 PsiBlast_CBE 77.3658% -82 - C5 -3SSQ 2.7 ?