@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1159: (2016-03-22 )
MNNALGMIETKGLVGAIEAADAMVKAANVSLVGYEKIGSGLVTVMVRGDVGAVKAATDAGAAAARNVGEVQSIHVIPRPHNDVETLLQKGL

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




TAR_D_22(4QIF)
PDUA_SALTY
[Raw transfer]




PGO_C_20(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




PGO_A_10(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_G_20(4P2S)
?
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_G_20(4P2S)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_D_17(4P2S)
?
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_D_17(4P2S)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_C_8(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_G_19(4P2S)
?
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_A_6(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_A_9(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_6(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_C_8(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_22(4QIF)
PDUA_SALTY
[Raw transfer]




53 PsiBlast_CBE 90.8680%-111 - C6 -4RBU - PDUA_SALTY -
41 PsiBlast_CBE 90.7581%-110 - C6 -4P2S 3.0 ?
63 PsiBlast_CBE 90.5380%-109 - C6 -4QIF 2.8 PDUA_SALTY
60 PsiBlast_CBE 89.6580%-102 - C6 -4QIF 3.0 PDUA_SALTY
34 PsiBlast_CBE 89.1681%-105 - C6 -4P2S 2.7 ?
50 PsiBlast_CBE 88.5880%-110 - C6 -4RBU - PDUA_SALTY -
11 PsiBlast_PDB 88.4578%-102 - C6 -4RBV - PDUA_SALTY -
43 PsiBlast_CBE 88.4081%-108 - C6 -4PPD 2.7 PDUA_SALTY
37 PsiBlast_CBE 88.2881%-101 - C6 -4P2S 2.7 ?
55 PsiBlast_CBE 88.2180% -98 - C6 -4RBU - PDUA_SALTY -
51 PsiBlast_CBE 88.1680%-114 - C6 -4RBU - PDUA_SALTY -
1 PsiBlast_PDB 88.0982%-101 - C6 -3NGK - PDUA_SALTY -
7 PsiBlast_PDB 87.9580% -98 - C6 -4QIG - PDUA_SALTY -
38 PsiBlast_CBE 87.8281%-108 - C6 -4P2S 2.7 ?
56 PsiBlast_CBE 87.7580%-108 - C6 -4RBU - PDUA_SALTY -
66 PsiBlast_CBE 87.6278%-107 - C6 -4RBV - PDUA_SALTY -
49 PsiBlast_CBE 87.5580%-102 - C6 -4QIG - PDUA_SALTY -
48 PsiBlast_CBE 87.4080%-107 - C6 -4QIG - PDUA_SALTY -
4 PsiBlast_PDB 86.8181%-106 - C6 -4P2S 2.8 ?
22 PsiBlast_CBE 86.7281%-103 - C6 -4P7V 2.9 ?
58 PsiBlast_CBE 86.6280% -98 - C6 -4QIF 2.8 PDUA_SALTY
25 PsiBlast_CBE 86.3481%-100 - C6 -4P7V 2.9 ?
40 PsiBlast_CBE 86.3081%-104 - C6 -4P2S 2.8 ?
35 PsiBlast_CBE 86.0881%-104 - C6 -4P2S 2.9 ?
6 PsiBlast_PDB 86.0581%-100 - C6 -4PPD 2.8 PDUA_SALTY
29 PsiBlast_CBE 85.9681% -89 - C6 -4QIE 2.7 PDUA_SALTY
39 PsiBlast_CBE 85.8881%-105 - C6 -4P2S 3.1 ?
30 PsiBlast_CBE 85.8781%-103 - C6 -4QIE 2.7 PDUA_SALTY
36 PsiBlast_CBE 85.3881% -99 - C6 -4P2S 3.2 ?
61 PsiBlast_CBE 85.3680%-102 - C6 -4QIF 2.7 PDUA_SALTY
23 PsiBlast_CBE 85.0581%-105 - C6 -4P7V 2.8 ?
27 PsiBlast_CBE 85.0081% -97 - C6 -4QIE Error PDUA_SALTY
3 PsiBlast_PDB 84.9181%-106 - C6 -4P7V 2.9 ?
5 PsiBlast_PDB 84.8481% -96 - C6 -4QIE 2.7 PDUA_SALTY
9 PsiBlast_PDB 84.8180% -97 - C6 -4QIF 2.9 PDUA_SALTY
32 PsiBlast_CBE 84.7581% -98 - C6 -4QIE 2.7 PDUA_SALTY
21 PsiBlast_CBE 84.6681%-101 - C6 -4P7V 2.7 ?
31 PsiBlast_CBE 84.5481% -92 - C6 -4QIE 2.6 PDUA_SALTY
33 PsiBlast_CBE 84.2881% -98 - C6 -4QIE 2.7 PDUA_SALTY
42 PsiBlast_CBE 83.5181%-106 - C6 -4PPD 2.7 PDUA_SALTY
87 PsiBlast_CBE 83.4660% -94 - C6 -3SSQ 2.7 ?
26 PsiBlast_CBE 83.4281%-102 - C6 -4QIE 2.8 PDUA_SALTY
59 PsiBlast_CBE 83.3780%-102 - C6 -4QIF 2.8 PDUA_SALTY
44 PsiBlast_CBE 83.2481% -95 - C6 -4PPD 2.8 PDUA_SALTY
24 PsiBlast_CBE 83.0681% -98 - C6 -4P7V 2.7 ?
62 PsiBlast_CBE 82.7880% -93 - C6 -4QIF 2.8 PDUA_SALTY
20 PsiBlast_PDB 82.6160% -93 - C6 -3SSQ 2.7 ?
64 PsiBlast_CBE 82.2580%-100 - C6 -4QIF 2.8 PDUA_SALTY
88 PsiBlast_CBE 82.0060% -90 - C6 -3SSQ 2.9 ?
90 PsiBlast_CBE 81.6860% -94 - C6 -3SSQ 2.7 ?
81 PsiBlast_CBE 81.5860%-108 - C6 -3CIM 2.8 CCMK2_SYNY3
91 PsiBlast_CBE 81.3860% -95 - C6 -3SSQ 3.0 ?
89 PsiBlast_CBE 81.3360% -93 - C6 -3SSQ 2.7 ?
28 PsiBlast_CBE 80.8581% -95 - C6 -4QIE 2.8 PDUA_SALTY
17 PsiBlast_PDB 80.6960% -99 - C6 -3CIM 2.7 CCMK2_SYNY3
57 PsiBlast_CBE 80.2880% -98 - C6 -4QIF 2.7 PDUA_SALTY
108 HHSearch 80.2260% -80 - C6 -3SSQ 2.7 ?
80 PsiBlast_CBE 79.8960% -98 - C6 -3CIM 2.8 CCMK2_SYNY3
101 HHSearch 78.4261% -86 * C6 *3CIM 2.7 CCMK2_SYNY3