Study : Lmo1180 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C6_S1
Best Complexes choosen after comparative docking [pKd > 3] : 2 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C6_S1
Complex: PGO_A_10(4QIF) / Model_62(4QIF/F) = [3.1] Download259.7655.20MANANALGMIETKGLVGAVEAADAMVKAANVTLMGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELLSVHVIPRPHSEVDAILPKSAE
Complex: PGO_C_20(4QIF) / Model_65(4QIF/C) = [3.1] Download211.5655.20MANANALGMIETKGLVGAVEAADAMVKAANVTLMGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELLSVHVIPRPHSEVDAILPKSAE
Consensus
[pKd Mean = 3.10]
-235
(s=24)
55
(s=0)
MANANALGMIETKGLVGAVEAADAMVKAANVTLMGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELLSVHVIPRPHSEVDAILPKSAE