@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1180: (2016-03-22 )
MANANALGMIETKGLVGAVEAADAMVKAANVTLMGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELLSVHVIPRPHSEVDAILPKSAE

Atome Classification :

(58 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TAR_D_22(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_B_16(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




TRS_A_2(2EWH)
CSOA_HALNC
[Raw transfer]




PGO_A_10(4QIF)
PDUA_SALTY
[Raw transfer]




PGO_C_20(4QIF)
PDUA_SALTY
[Raw transfer]




TRS_A_2(2EWH)
CSOA_HALNC
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_C_8(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_G_20(4P2S)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_G_13(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_G_19(4P2S)
?
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_D_17(4P2S)
?
[Raw transfer]




GOL_G_19(4P2S)
?
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_A_9(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_E_7(4P7V)
?
[Raw transfer]




GOL_E_14(4PPD)
PDUA_SALTY
[Raw transfer]




GOL_B_14(4P2S)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_6(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_A_10(4QIE)
PDUA_SALTY
[Raw transfer]




GOL_B_16(4QIF)
PDUA_SALTY
[Raw transfer]




GOL_A_6(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_C_8(3CIM)
CCMK2_SYNY3
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




GOL_A_7(3SSQ)
?
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_G_(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_22(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




TAR_D_21(4QIF)
PDUA_SALTY
[Raw transfer]




22 PsiBlast_CBE 90.0092% -79 - C6 -4AXJ - ? -
21 PsiBlast_CBE 89.6792% -87 - C6 -4AXJ - ? -
3 PsiBlast_PDB 88.1174% -96 - C6 -4P7V 2.9 ?
50 PsiBlast_CBE 88.0571% -96 - C6 -4RBU - PDUA_SALTY -
31 PsiBlast_CBE 87.5074% -87 - C6 -4QIE 2.7 PDUA_SALTY
68 PsiBlast_CBE 87.3569%-103 - C6 -3MPW - EUTM_ECOLI -
53 PsiBlast_CBE 87.2671% -92 - C6 -4RBU - PDUA_SALTY -
57 PsiBlast_CBE 86.9874% -97 - C6 -4QIG - PDUA_SALTY -
84 PsiBlast_CBE 86.4773% -98 - C6 -4RBV - PDUA_SALTY -
26 PsiBlast_CBE 86.3174% -92 - C6 -4P7V 2.7 ?
23 PsiBlast_CBE 86.2974% -92 - C6 -4P7V 2.7 ?
27 PsiBlast_CBE 86.2774% -90 - C6 -4P7V 2.9 ?
58 PsiBlast_CBE 86.2274% -94 - C6 -4QIG - PDUA_SALTY -
56 PsiBlast_CBE 86.1171% -94 - C6 -4RBU - PDUA_SALTY -
29 PsiBlast_CBE 86.0874% -94 - C6 -4QIE Error PDUA_SALTY
34 PsiBlast_CBE 85.9974% -86 - C6 -4QIE 2.7 PDUA_SALTY
24 PsiBlast_CBE 85.8874% -90 - C6 -4P7V 2.9 ?
18 PsiBlast_PDB 85.7173% -96 - C6 -4RBV - PDUA_SALTY -
9 PsiBlast_PDB 85.5874% -96 - C6 -4QIG - PDUA_SALTY -
15 PsiBlast_PDB 85.4969% -92 - C6 -3MPY - EUTM_ECOLI -
65 PsiBlast_CBE 85.4471% -96 - C6 -4QIF 3.1 PDUA_SALTY
35 PsiBlast_CBE 85.4474% -94 - C6 -4QIE 2.7 PDUA_SALTY
28 PsiBlast_CBE 85.4474% -93 - C6 -4QIE 2.8 PDUA_SALTY
38 PsiBlast_CBE 85.3874% -87 - C6 -4PPD 2.8 PDUA_SALTY
13 PsiBlast_PDB 85.1964% -84 - C6 -2EWH 2.7 CSOA_HALNC
45 PsiBlast_CBE 85.0871% -93 - C6 -4P2S 2.7 ?
46 PsiBlast_CBE 85.0471% -94 - C6 -4P2S 2.7 ?
48 PsiBlast_CBE 85.0071% -89 - C6 -4P2S 2.6 ?
62 PsiBlast_CBE 84.8571% -90 - C6 -4QIF 3.1 PDUA_SALTY
42 PsiBlast_CBE 84.5271% -91 - C6 -4P2S 2.7 ?
6 PsiBlast_PDB 84.4974% -98 - C6 -4PPD 2.8 PDUA_SALTY
36 PsiBlast_CBE 84.4874%-100 - C6 -4PPD 2.6 PDUA_SALTY
37 PsiBlast_CBE 84.3874% -97 - C6 -4PPD 2.7 PDUA_SALTY
60 PsiBlast_CBE 84.3671% -85 - C6 -4QIF 2.8 PDUA_SALTY
32 PsiBlast_CBE 83.9974% -95 - C6 -4QIE 2.7 PDUA_SALTY
5 PsiBlast_PDB 83.5271% -93 - C6 -4P2S 2.8 ?
47 PsiBlast_CBE 83.4971% -95 - C6 -4P2S 2.7 ?
33 PsiBlast_CBE 83.4674% -85 - C6 -4QIE 2.7 PDUA_SALTY
25 PsiBlast_CBE 83.0274% -93 - C6 -4P7V 2.8 ?
49 PsiBlast_CBE 82.9471% -91 - C6 -4P2S 2.9 ?
86 PsiBlast_CBE 82.8358% -98 - C6 -3CIM 2.7 CCMK2_SYNY3
66 PsiBlast_CBE 82.8371% -87 - C6 -4QIF 2.8 PDUA_SALTY
44 PsiBlast_CBE 82.8171% -84 - C6 -4P2S 2.6 ?
87 PsiBlast_CBE 82.5058% -99 - C6 -3CIM 2.9 CCMK2_SYNY3
95 PsiBlast_CBE 82.4658% -94 - C6 -3SSQ 2.6 ?
43 PsiBlast_CBE 82.4071% -88 - C6 -4P2S 2.8 ?
4 PsiBlast_PDB 82.1774% -88 - C6 -4QIE 2.6 PDUA_SALTY
88 PsiBlast_CBE 82.1558% -93 - C6 -3CIM 2.7 CCMK2_SYNY3
63 PsiBlast_CBE 81.8271% -89 - C6 -4QIF 2.7 PDUA_SALTY
61 PsiBlast_CBE 81.5071% -88 - C6 -4QIF 2.8 PDUA_SALTY
92 PsiBlast_CBE 81.4658% -91 - C6 -3SSQ 2.7 ?
10 PsiBlast_PDB 81.3171% -81 - C6 -4QIF 2.8 PDUA_SALTY
114 HHSearch 81.0062% -82 - C6 -2EWH 2.7 CSOA_HALNC
64 PsiBlast_CBE 80.8971% -82 - C6 -4QIF 2.8 PDUA_SALTY
30 PsiBlast_CBE 80.0474% -86 - C6 -4QIE 2.8 PDUA_SALTY
59 PsiBlast_CBE 79.6271% -87 - C6 -4QIF 2.7 PDUA_SALTY
118 HHSearch 79.5855% -77 - C6 -3SSQ 2.6 ?
113 HHSearch 79.3157% -78 * C6 *3CIM 2.7 CCMK2_SYNY3