Study : Lmo1227 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C8_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C8_S1
Complex: TUL_A_2(4WS8) / Model_46(4WS8/A) = [3.1] Download470.8522.44MIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI
Complex: GOL_B_5(1OKB) / Model_36(1OKB/B) = [3.1] Download311.1621.50MIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI
Complex: CIT_A_2(4WRY) / Model_56(4WRY/A) = [3.1] Download849.6514.27MIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI
Complex: URF_A_2(4WS1) / Model_53(4WS1/A) = [3.2] Download233.0915.44MIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI
Complex: GOL_A_3(1OKB) / Model_37(1OKB/A) = [3.2] Download257.6621.50MIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI
Consensus
[pKd Mean = 3.14]
-424
(s=228)
19
(s=3)
MIKLGNDWDELLKNEFNQPYYLTLRQFLKKEYQTKKVFPDMYDIFNALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQQGVQIPPSLQNIYLELHNDLNCEIPNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWEILTNHIIEIINQKEEPVVFLLWGSNAKEKLQLLTNPKHTAFTSVHPSPLSASRGFMGCKHFSKTNQFLEQNGVKPIDWQIPSI