@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1246: (2016-03-22 )
MNNLKLSEEIKRAINELGYTEATPVQKAVIPVALTGEDIVAKSQTGSGKTAAFAIPIAEQVEWEENKPQALIIVPTRELAMQVKTECTNIGRFKRVKAAAIYGQSPFAKQKLELSQKNHIVVGTPGRLLDHIEKGSLNVDKVAHLVLDEVDEMLSMGFIDQVEDILSRLPKQRQNLFFSATMPEEMQDLIKRYQDNPMVIEMASEKTNPIFHVEMQTDNKEKTLKDVLITENPDSAIIFCNTKNQVDELTDLLDVKASKIHGGLRQEDRFRAMDDFKSGKSRFLIATDVAGRGIDVDNVSLVINYDLPIEKENYVHRIGRTGRAGKSGKAISFVKTNENPLLRDIEEMLDVTIEKKRKPTVIEVKVNEDAFRKKQQKRPTIKKARGEKLNKNIMKLYFNGGKKKKIRAVDFVGTISKLEGITAEDIGIITIEDHVSFVEILNGKGPAVLEMMRSRKVKGRRLKVNEARKR

Atome Classification :

(58 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_3(3G0H)
DD19B_HUMAN
[Raw transfer]




ANP_A_3(3I5X)
MS116_YEAST
[Raw transfer]




ANP_A_3(4D25)
?
[Raw transfer]




ANP_A_3(3I5X)
MS116_YEAST
[Raw transfer]




ANP_A_3(3SQW)
MS116_YEAST
[Raw transfer]




ANP_A_3(3SQW)
MS116_YEAST
[Raw transfer]




ANP_A_7(3FHT)
DD19B_HUMAN
[Raw transfer]




ANP_B_12(3FHT)
DD19B_HUMAN
[Raw transfer]




ANP_A_7(3FHT)
DD19B_HUMAN
[Raw transfer]




ANP_A_3(3I5Y)
MS116_YEAST
[Raw transfer]




ADP_A_3(3I61)
MS116_YEAST
[Raw transfer]




ADP_A_3(4D26)
?
[Raw transfer]




ANP_A_3(3SQX)
MS116_YEAST
[Raw transfer]




8OD_B_7(3NBF)
?
[Raw transfer]




ADP_A_3(3I62)
MS116_YEAST
[Raw transfer]




ADP_A_3(3PEY)
DBP5_YEAST
[Raw transfer]




ADP_A_3(3PEY)
DBP5_YEAST
[Raw transfer]




ANP_A_7(2J0S)
IF4A3_HUMAN
[Raw transfer]




ADP_A_3(3PEW)
DBP5_YEAST
[Raw transfer]




8OP_C_10(3NBF)
?
[Raw transfer]




AMP_A_2(2GXQ)
?
[Raw transfer]




ADP_A_4(4PX9)
DDX3X_HUMAN
[Raw transfer]




ADP_B_5(4PX9)
DDX3X_HUMAN
[Raw transfer]




ADP_C_6(4PX9)
DDX3X_HUMAN
[Raw transfer]




AMP_A_8(2GXS)
?
[Raw transfer]




ADP_A_3(2PL3)
DDX10_HUMAN
[Raw transfer]




AMP_A_2(2I4I)
DDX3X_HUMAN
[Raw transfer]




ADP_A_2(4PXA)
DDX3X_HUMAN
[Raw transfer]




ADP_A_4(3FE2)
DDX5_HUMAN
[Raw transfer]




8OX_B_6(3MWL)
?
[Raw transfer]




AMP_A_2(2I4I)
DDX3X_HUMAN
[Raw transfer]




8OP_B_6(3MWK)
?
[Raw transfer]




AMP_A_3(3BER)
DDX47_HUMAN
[Raw transfer]




AMP_B_9(2GXS)
?
[Raw transfer]




ADP_B_8(3FE2)
DDX5_HUMAN
[Raw transfer]




8OD_A_5(3NBF)
?
[Raw transfer]




ADP_A_3(3DKP)
DDX52_HUMAN
[Raw transfer]




AMP_A_3(4KBF)
?
[Raw transfer]




8OP_D_12(3NBF)
?
[Raw transfer]




FLC_C_3(1T6N)
DX39B_HUMAN
[Raw transfer]




FLC_D_4(1T6N)
DX39B_HUMAN
[Raw transfer]




1PE_A_4(4BRW)
DHH1_YEAST
[Raw transfer]




IPA_D_4(1XTI)
DX39B_HUMAN
[Raw transfer]




109 HHSearch 87.1445% -89 - C6 -1HV8 - H669_METJA -
11 PsiBlast_PDB 86.0237% -97 - C6 -2I4I 6.0 DDX3X_HUMAN
12 PsiBlast_PDB 85.5737% -84 - C6 -4PXA 5.0 DDX3X_HUMAN
7 PsiBlast_PDB 85.4644% -91 - C6 -1HV8 - H669_METJA -
113 HHSearch 84.2039% -90 - C6 -2I4I 6.0 DDX3X_HUMAN
29 PsiBlast_CBE 83.7737% -92 - C6 -4CT4 - DDX6_HUMAN -
10 PsiBlast_PDB 83.5037% -92 - C6 -4CT4 - DDX6_HUMAN -
2 PsiBlast_PDB 83.0238% -81 - C6 -2HYI - IF4A3_HUMAN -
3 PsiBlast_PDB 82.9938% -82 - C6 -3EX7 - IF4A3_HUMAN -
22 PsiBlast_CBE 82.9038% -81 - C6 -3EX7 - IF4A3_HUMAN -
1 PsiBlast_PDB 82.8938% -79 - C6 -2XB2 - IF4A3_HUMAN -
4 PsiBlast_PDB 82.6938% -76 - C6 -2J0Q - IF4A3_HUMAN -
24 PsiBlast_CBE 82.6638% -77 - C6 -2J0Q - IF4A3_HUMAN -
5 PsiBlast_PDB 82.6038% -82 - C6 -2J0S 8.5 IF4A3_HUMAN
23 PsiBlast_CBE 82.3638% -80 - C6 -2HYI - IF4A3_HUMAN -
6 PsiBlast_PDB 82.3338% -87 - C6 -2HXY - IF4A3_HUMAN -
35 PsiBlast_CBE 81.8937%-102 - C6 -2VSO - IF4A_YEAST -
36 PsiBlast_CBE 81.5837%-101 - C6 -2VSO - IF4A_YEAST -
28 PsiBlast_CBE 81.3037% -91 - C6 -4CT5 - DDX6_HUMAN -
49 PsiBlast_CBE 81.0433% -88 - C6 -3FHT 7.4 DD19B_HUMAN
52 PsiBlast_CBE 80.0733% -90 - C6 -3G0H 6.2 DD19B_HUMAN
19 PsiBlast_PDB 79.7837% -83 - C6 -4D26 7.2 ?
18 PsiBlast_PDB 79.7037% -83 - C6 -4D25 9.6 ?
48 PsiBlast_CBE 78.4933% -90 - C6 -3FHT 7.2 DD19B_HUMAN
37 PsiBlast_CBE 78.1132%-104 - C6 -1XTI 3.8 DX39B_HUMAN
107 HHSearch 77.9733% -85 - C6 -3FHT 7.4 DD19B_HUMAN
15 PsiBlast_PDB 77.7036% -84 - C6 -4BRW 1.9 DHH1_YEAST
8 PsiBlast_PDB 75.8740% -92 - C6 -4KBF 5.3 ?
42 PsiBlast_CBE 75.7334% -70 - C6 -3PEY 7.7 DBP5_YEAST
41 PsiBlast_CBE 75.5134% -71 - C6 -3PEW 7.0 DBP5_YEAST
110 HHSearch 74.4334% -84 - C6 -3PEY 5.8 DBP5_YEAST
111 HHSearch 73.5532% -74 - C6 -3SQW 9.1 MS116_YEAST
105 HHSearch 73.0632% -76 - C6 -3I5X 6.8 MS116_YEAST
66 PsiBlast_CBE 72.7731% -74 - C6 -3I5Y 7.2 MS116_YEAST
65 PsiBlast_CBE 72.6431% -73 - C6 -3I61 7.5 MS116_YEAST
68 PsiBlast_CBE 72.6131% -78 - C6 -3SQW 9.0 MS116_YEAST
67 PsiBlast_CBE 72.1531% -74 - C6 -3I5X 6.8 MS116_YEAST
63 PsiBlast_CBE 71.8331% -74 - C6 -3SQX 9.6 MS116_YEAST
64 PsiBlast_CBE 71.7131% -73 - C6 -3I62 7.0 MS116_YEAST
44 PsiBlast_CBE 63.5244%-108 - C6 -2GXS 4.9 ?
46 PsiBlast_CBE 63.1944%-105 - C6 -2GXQ 6.2 ?
45 PsiBlast_CBE 62.9644%-106 - C6 -2GXS 5.1 ?
56 PsiBlast_CBE 62.9544% -96 - C6 -3NBF 3.9 ?
57 PsiBlast_CBE 62.4844%-111 - C6 -3MWL 3.6 ?
53 PsiBlast_CBE 62.2344%-109 - C6 -3NBF 4.5 ?
55 PsiBlast_CBE 61.9244%-100 - C6 -3NBF 5.6 ?
76 PsiBlast_CBE 61.8836% -95 - C6 -4PX9 5.6 DDX3X_HUMAN
74 PsiBlast_CBE 61.7536% -95 - C6 -4PX9 5.2 DDX3X_HUMAN
59 PsiBlast_CBE 61.6644%-105 - C6 -3MWK 4.4 ?
54 PsiBlast_CBE 61.5644%-105 - C6 -3NBF 4.6 ?
75 PsiBlast_CBE 61.4336% -94 - C6 -4PX9 5.5 DDX3X_HUMAN
82 PsiBlast_CBE 59.6434%-106 - C6 -1T6N 2.6 DX39B_HUMAN
71 PsiBlast_CBE 58.4838% -96 - C6 -3BER 5.0 DDX47_HUMAN
81 PsiBlast_CBE 58.1934%-105 - C6 -1T6N 3.0 DX39B_HUMAN
80 PsiBlast_CBE 57.7137% -97 - C6 -2PL3 6.1 DDX10_HUMAN
78 PsiBlast_CBE 52.1339% -88 - C6 -3FE2 6.1 DDX5_HUMAN
79 PsiBlast_CBE 51.9539% -86 - C6 -3FE2 6.1 DDX5_HUMAN
98 PsiBlast_CBE 51.6633% -83 - C6 -3DKP 5.9 DDX52_HUMAN