Study : Lmo1295 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C6_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C6_S1
Complex: UTP_E_11(4J6X) / Model_52(4J6X/E) = [3.1] Download839.4816.09MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALNPDAE
Complex: PGO_F_12(4NL2) / Model_33(4NL2/C) = [3.1] Download616.9110.40MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALNPDAE
Complex: NACID_R_13(4NL3) / Model_30(4NL3/B) = [3.1] Download--MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALNPDAE
Complex: UTP_A_7(4J6X) / Model_11(4J6X/A) = [3.2] Download950.6416.09MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALNPDAE
Complex: UTP_F_12(4J6X) / Model_51(4J6X/F) = [3.3] Download809.647.70MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALNPDAE
Consensus
[pKd Mean = 3.16]
-804
(s=120)
12
(s=3)
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALNPDAE