@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1295: (2016-03-23 )
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALNPDAE

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGO_D_7(4NL2)
?
[Raw transfer]




NACID_R_13(4NL3)
?
[Raw transfer]

-

NACID_Z_14(4NL3)
?
[Raw transfer]

-

C_E_22(4J6W)
HFQ_PSEAE
[Raw transfer]




CTP_B_11(4J6W)
HFQ_PSEAE
[Raw transfer]




C_D_17(4J6W)
HFQ_PSEAE
[Raw transfer]




NACID_Z_14(4NL3)
?
[Raw transfer]

-

NACID_R_13(4NL3)
?
[Raw transfer]

-

NACID_R_13(4NL3)
?
[Raw transfer]

-

NACID_Z_14(4NL3)
?
[Raw transfer]

-

NACID_R_13(4NL3)
?
[Raw transfer]

-

NACID_R_13(4NL3)
?
[Raw transfer]

-

NACID_Z_14(4NL3)
?
[Raw transfer]

-

NACID_Z_14(4NL3)
?
[Raw transfer]

-

ANP_D_11(3QUI)
HFQ_PSEAE
[Raw transfer]




CTP_B_11(4J6W)
HFQ_PSEAE
[Raw transfer]




C_C_14(4J6W)
HFQ_PSEAE
[Raw transfer]




UTP_C_9(4J6X)
HFQ_PSEAE
[Raw transfer]




PGO_B_11(4NL2)
?
[Raw transfer]




UTP_B_8(4J6X)
HFQ_PSEAE
[Raw transfer]




UTP_E_11(4J6X)
HFQ_PSEAE
[Raw transfer]




UTP_D_10(4J6X)
HFQ_PSEAE
[Raw transfer]




PGO_F_13(4NL2)
?
[Raw transfer]




UTP_A_7(4J6X)
HFQ_PSEAE
[Raw transfer]




UTP_F_12(4J6X)
HFQ_PSEAE
[Raw transfer]




PGO_F_14(4NOY)
?
[Raw transfer]




NACID_Z_14(4NL3)
?
[Raw transfer]

-

NACID_R_13(4NL3)
?
[Raw transfer]

-

PGO_F_12(4NL2)
?
[Raw transfer]




C_E_22(4J6W)
HFQ_PSEAE
[Raw transfer]




PEG_D_12(4J5Y)
HFQ_PSEAE
[Raw transfer]




PGO_D_7(4NOY)
?
[Raw transfer]




ANP_D_11(3QUI)
HFQ_PSEAE
[Raw transfer]




ANP_D_11(3QUI)
HFQ_PSEAE
[Raw transfer]




PGO_D_7(4NL2)
?
[Raw transfer]




PGO_B_12(4NOY)
?
[Raw transfer]




PGO_D_7(4NOY)
?
[Raw transfer]




PGO_F_13(4NOY)
?
[Raw transfer]




24 PsiBlast_CBE 95.14100%-151 - C6 -4NL3 3.4 ?
27 PsiBlast_CBE 94.63100%-149 - C6 -4NL3 3.4 ?
36 PsiBlast_CBE 94.6298%-141 - C6 -4NOY 2.5 ?
32 PsiBlast_CBE 94.23100%-150 - C6 -4NL2 2.3 ?
21 PsiBlast_CBE 94.05100%-148 - C6 -4NL3 4.0 ?
33 PsiBlast_CBE 94.04100%-142 - C6 -4NL2 3.1 ?
29 PsiBlast_CBE 93.31100%-144 - C6 -4NL3 2.9 ?
2 PsiBlast_PDB 93.11100%-148 - C6 -4NL3 3.9 ?
1 PsiBlast_PDB 92.97100%-148 - C6 -4NL2 3.4 ?
39 PsiBlast_CBE 92.1798%-140 - C6 -4NOY 2.8 ?
23 PsiBlast_CBE 92.02100%-142 - C6 -4NL3 4.3 ?
37 PsiBlast_CBE 91.9598%-146 - C6 -4NOY 2.6 ?
22 PsiBlast_CBE 91.88100%-146 - C6 -4NL3 4.1 ?
26 PsiBlast_CBE 91.84100%-145 - C6 -4NL3 4.3 ?
35 PsiBlast_CBE 91.32100%-147 - C6 -4NL2 Error ?
28 PsiBlast_CBE 91.29100%-150 - C6 -4NL3 3.9 ?
3 PsiBlast_PDB 91.1698%-147 - C6 -4NOY 3.5 ?
31 PsiBlast_CBE 90.56100%-141 - C6 -4NL3 4.3 ?
34 PsiBlast_CBE 90.23100%-148 - C6 -4NL2 2.4 ?
38 PsiBlast_CBE 90.2198%-154 - C6 -4NOY 3.8 ?
25 PsiBlast_CBE 89.16100%-146 - C6 -4NL3 4.4 ?
30 PsiBlast_CBE 89.02100%-144 - C6 -4NL3 3.1 ?
56 PsiBlast_CBE 74.9448%-147 - C6 -4J6W 2.9 HFQ_PSEAE
53 PsiBlast_CBE 74.5048%-147 - C6 -4J6X 2.7 HFQ_PSEAE
58 PsiBlast_CBE 74.3948%-152 - C6 -4J6W 2.9 HFQ_PSEAE
68 PsiBlast_CBE 73.5248%-145 - C6 -3QUI 3.8 HFQ_PSEAE
54 PsiBlast_CBE 73.4848%-148 - C6 -4J6X 3.0 HFQ_PSEAE
67 PsiBlast_CBE 73.4048%-139 - C6 -3QUI 2.7 HFQ_PSEAE
51 PsiBlast_CBE 73.3848%-147 - C6 -4J6X 3.3 HFQ_PSEAE
52 PsiBlast_CBE 72.5948%-139 - C6 -4J6X 3.1 HFQ_PSEAE
60 PsiBlast_CBE 72.4348%-141 - C6 -4J6W 3.4 HFQ_PSEAE
69 PsiBlast_CBE 72.2448%-140 - C6 -3QUI 3.0 HFQ_PSEAE
11 PsiBlast_PDB 72.2348%-144 - C6 -4J6X 3.2 HFQ_PSEAE
63 PsiBlast_CBE 72.0148%-141 - C6 -4J5Y 3.0 HFQ_PSEAE
55 PsiBlast_CBE 71.2748%-149 - C6 -4J6X 2.6 HFQ_PSEAE
59 PsiBlast_CBE 70.9948%-147 - C6 -4J6W 2.7 HFQ_PSEAE
57 PsiBlast_CBE 70.8648%-146 - C6 -4J6W 3.5 HFQ_PSEAE
10 PsiBlast_PDB 70.3648%-141 - C6 -4J6W 2.1 HFQ_PSEAE