@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1315: (2016-03-23 )
MFKKLFRQDENILNSELAEDLPIPRHVAIIMDGNGRWAKKRFLPRIAGHKEGMDVVKRVTRYANAIGIDVLTLYAFSTENWKRPTDEVDFLMKLPVEFFDSFVPELIEENVRVNVMGYRENLPDHTMRAVEKAIADTAHCTGLTLNFALNYGGRSEIITAAKEAMKELELEGKSADDLTEEKLNDHLMSSGLGDPDLLIRTSGELRLSNFMLWQLAYSEFYFTDTHWPDFSKEDFLQAIIEYQNRSRRFGGL

Atome Classification :

(55 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GPP_D_19(2VG3)
DPDS_MYCTU
[Raw transfer]




H78_A_3(3WYJ)
UPPS_ECOLI
[Raw transfer]




B75_B_5(2E9C)
UPPS_ECOLI
[Raw transfer]




B08_A_3(2E99)
UPPS_ECOLI
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




FPS_C_3(1X08)
UPPS_ECOLI
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




FPP_C_3(1V7U)
UPPS_ECOLI
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




FPS_A_3(4U82)
ISPT_STAAN
[Raw transfer]




FPS_A_4(1X06)
UPPS_ECOLI
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




GPP_B_9(2VG3)
DPDS_MYCTU
[Raw transfer]




IPE_A_3(1X09)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X07)
UPPS_ECOLI
[Raw transfer]




DPO_C_20(2VG2)
DPDS_MYCTU
[Raw transfer]




B76_A_3(2E9D)
UPPS_ECOLI
[Raw transfer]




GPP_A_3(2VG0)
ZFPP_MYCTU
[Raw transfer]




2BJ_A_5(3SGV)
UPPS_ECOLI
[Raw transfer]




GPP_A_3(2VG0)
ZFPP_MYCTU
[Raw transfer]




40B_B_4(4ONC)
DPDS_MYCTU
[Raw transfer]




GPP_C_15(2VG3)
DPDS_MYCTU
[Raw transfer]




DPO_A_5(2VG2)
DPDS_MYCTU
[Raw transfer]




DPO_C_3(2DTN)
ISPT_HELPY
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




B28_B_5(2E9A)
UPPS_ECOLI
[Raw transfer]




TH9_B_3(3TH8)
UPPS_ECOLI
[Raw transfer]




GOL_B_19(2VG2)
DPDS_MYCTU
[Raw transfer]




B08_A_5(2E99)
UPPS_ECOLI
[Raw transfer]




0FW_A_4(3SGX)
UPPS_ECOLI
[Raw transfer]




40B_A_3(4ONC)
DPDS_MYCTU
[Raw transfer]




B29_A_4(2E98)
UPPS_ECOLI
[Raw transfer]




B29_A_5(2E98)
UPPS_ECOLI
[Raw transfer]




FPP_B_11(2VG1)
ZFPP_MYCTU
[Raw transfer]




P09_B_3(3SGT)
UPPS_ECOL6
[Raw transfer]




FFT_A_4(3UGS)
ISPT_CAMJE
[Raw transfer]




SAX_B_3(3SH0)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




B28_A_4(2E9A)
UPPS_ECOLI
[Raw transfer]




B08_B_7(2E99)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




0YU_A_3(4H2J)
UPPS_ECOLI
[Raw transfer]




IPE_B_15(2VG2)
DPDS_MYCTU
[Raw transfer]




IPE_A_6(2VG2)
DPDS_MYCTU
[Raw transfer]




0YW_B_4(4H2O)
UPPS_ECOLI
[Raw transfer]




2ZW_A_3(4Q9O)
ISPT_STRR6
[Raw transfer]




B29_B_8(2E98)
UPPS_ECOLI
[Raw transfer]




0YZ_A_4(4H3C)
UPPS_ECOLI
[Raw transfer]




53Q_A_3(5CQJ)
?
[Raw transfer]




2BJ_A_7(3SGV)
UPPS_ECOLI
[Raw transfer]




OXN_B_11(1UEH)
UPPS_ECOLI
[Raw transfer]




2ZW_B_5(4Q9O)
ISPT_STRR6
[Raw transfer]




0YU_B_4(4H2J)
UPPS_ECOLI
[Raw transfer]




B75_A_6(2E9C)
UPPS_ECOLI
[Raw transfer]




0YV_A_3(4H2M)
UPPS_ECOLI
[Raw transfer]




3 PsiBlast_PDB 93.2152% -94 - C8 -4U82 9.9 ISPT_STAAN
2 PsiBlast_PDB 93.0852% -93 - C8 -4H8E 10.0 ISPT_STAAN
6 PsiBlast_PDB 92.5253% -90 - C8 -4Q9O 8.6 ISPT_STRR6
4 PsiBlast_PDB 92.5152% -90 - C8 -3WYI - ? -
49 PsiBlast_CBE 92.4848% -89 - C8 -1X08 8.1 UPPS_ECOLI
10 PsiBlast_PDB 92.4548% -89 - C8 -1X07 6.0 UPPS_ECOLI
9 PsiBlast_PDB 92.4248% -88 - C8 -1X06 9.6 UPPS_ECOLI
12 PsiBlast_PDB 92.1348% -85 - C8 -2E99 7.4 UPPS_ECOLI
22 PsiBlast_CBE 91.8653% -92 - C8 -4Q9O 8.6 ISPT_STRR6
48 PsiBlast_CBE 91.3348% -87 - C8 -1X09 5.0 UPPS_ECOLI
5 PsiBlast_PDB 91.0953% -91 - C8 -4Q9M 8.4 ISPT_STRR6
23 PsiBlast_CBE 90.9553% -91 - C8 -4Q9M 8.4 ISPT_STRR6
51 PsiBlast_CBE 90.9143% -97 - C8 -4ONC 7.3 DPDS_MYCTU
8 PsiBlast_PDB 90.4948% -87 - C8 -1V7U 7.0 UPPS_ECOLI
46 PsiBlast_CBE 90.3848% -90 - C8 -1UEH 3.8 UPPS_ECOLI
35 PsiBlast_CBE 89.5148% -95 - C8 -3WYJ 9.9 UPPS_ECOLI
37 PsiBlast_CBE 89.0548% -94 - C8 -3SH0 4.7 UPPS_ECOLI
11 PsiBlast_PDB 88.9948% -87 - C8 -2E98 6.6 UPPS_ECOLI
70 HHSearch 88.7454% -99 - C8 -1F75 - UPPS_MICLU -
39 PsiBlast_CBE 88.6748% -92 - C8 -3SGV 5.2 UPPS_ECOLI
18 PsiBlast_PDB 88.5948% -94 - C8 -3SGT 6.3 UPPS_ECOL6
34 PsiBlast_CBE 88.0148% -91 - C8 -4H2J 5.4 UPPS_ECOLI
15 PsiBlast_PDB 87.5248% -94 - C8 -2E9D 5.1 UPPS_ECOLI
42 PsiBlast_CBE 87.2148% -95 - C8 -2E9A 3.9 UPPS_ECOLI
59 PsiBlast_CBE 87.1343% -94 - C8 -2VG2 3.1 DPDS_MYCTU
33 PsiBlast_CBE 87.1248% -93 - C8 -4H2J 5.9 UPPS_ECOLI
50 PsiBlast_CBE 86.6943% -98 - C8 -4ONC 4.4 DPDS_MYCTU
44 PsiBlast_CBE 86.5248% -91 - C8 -2E98 4.2 UPPS_ECOLI
20 PsiBlast_PDB 86.5248% -97 - C8 -3SGX 5.0 UPPS_ECOLI
13 PsiBlast_PDB 86.4748% -92 - C8 -2E9A 6.0 UPPS_ECOLI
57 PsiBlast_CBE 86.4643% -96 - C8 -2VG2 3.8 DPDS_MYCTU
32 PsiBlast_CBE 86.4648% -94 - C8 -4H2M 2.9 UPPS_ECOLI
54 PsiBlast_CBE 86.4143% -97 - C8 -2VG3 7.9 DPDS_MYCTU
56 PsiBlast_CBE 86.4043%-101 - C8 -2VG2 2.6 DPDS_MYCTU
55 PsiBlast_CBE 86.2043% -93 - C8 -2VG3 7.9 DPDS_MYCTU
19 PsiBlast_PDB 86.1448% -93 - C8 -3SGV 7.0 UPPS_ECOLI
43 PsiBlast_CBE 86.0848% -92 - C8 -2E99 5.0 UPPS_ECOLI
58 PsiBlast_CBE 85.8443% -96 - C8 -2VG2 4.2 DPDS_MYCTU
41 PsiBlast_CBE 85.7948% -91 - C8 -2E9C 7.4 UPPS_ECOLI
53 PsiBlast_CBE 85.7443% -97 - C8 -2VG3 7.3 DPDS_MYCTU
26 PsiBlast_CBE 85.4448% -94 - C8 -4H3C 4.1 UPPS_ECOLI
69 HHSearch 85.3647% -89 - C8 -3SGV 7.0 UPPS_ECOLI
36 PsiBlast_CBE 85.2948% -93 - C8 -3TH8 5.5 UPPS_ECOLI
14 PsiBlast_PDB 84.8448% -90 - C8 -2E9C 2.8 UPPS_ECOLI
52 PsiBlast_CBE 84.7243%-101 - C8 -2VG3 7.3 DPDS_MYCTU
71 HHSearch 84.5640% -81 - C8 -2VG3 7.9 DPDS_MYCTU
24 PsiBlast_CBE 83.6648% -96 - C8 -5CQJ 3.6 ?
74 HHSearch 81.5336% -98 - C8 -2VG0 6.8 ZFPP_MYCTU
30 PsiBlast_CBE 81.2248% -96 - C8 -4H2O 4.0 UPPS_ECOLI
62 PsiBlast_CBE 79.5939%-107 - C8 -3UGS 5.4 ISPT_CAMJE
61 PsiBlast_CBE 79.0439%-106 - C8 -3UGS 5.3 ISPT_CAMJE
72 HHSearch 78.8037%-100 - C8 -3UGS 5.3 ISPT_CAMJE
60 PsiBlast_CBE 78.5840% -96 - C8 -2DTN 4.7 ISPT_HELPY
63 PsiBlast_CBE 76.8636% -93 - C8 -2VG1 7.0 ZFPP_MYCTU
66 PsiBlast_CBE 76.1036% -92 - C8 -2VG0 6.8 ZFPP_MYCTU