@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1357: (2016-03-23 )
MIKKVLVANRGEIAVRIIRAAKELGVETVAIYSEADREALHIQLADEAYCVGPAATKDSYLNMSNIISLAVLTNCDAIHPGYGFLAENADFAELCEDCNITFIGPSASAISQMGTKDVARETMRKAGVPIVPGSQGIVADVEDGKKIAKKIGYPVIIKATAGGGGKGIRVAENEEKLISGIHTTQQEAEAAFGDPGVYLEKYIQDFRHVEIQVLADNHGNVIHLGERDCSIQRRLQKLIEESPSPAIDEKTRQKMGKAAVKAAKAVNYSGAGTIEFIYDHHENNFYFMEMNTRIQVEHPVTELVTGIDLVKQQFLVASGEELQIKQADVKLTGWAMECRINAENPEKNFMPAPGEIKFYLPPGGLGVRIDSAAYPNYKIPPYYDSMIAKVICYAETREEVIQKMKRALSEFAIDGIPSTIPFHLRVLDNDVFLSGDFNTKFLEQNDVMNLSKEG

Atome Classification :

(46 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_7(3G8C)
ACCC_ECOLI
[Raw transfer]




ANP_A_5(2J9G)
ACCC_ECOLI
[Raw transfer]




ADP_B_4(3G8D)
ACCC_ECOLI
[Raw transfer]




ADP_A_4(3RV3)
ACCC_ECOLI
[Raw transfer]




ADP_A_4(3RUP)
ACCC_ECOLI
[Raw transfer]




ADP_A_2(3RV4)
ACCC_ECOLI
[Raw transfer]




ANP_A_3(2VPQ)
?
[Raw transfer]




ADP_A_3(3G8C)
ACCC_ECOLI
[Raw transfer]




ATP_A_3(1DV2)
ACCC_ECOLI
[Raw transfer]




ANP_B_7(2VPQ)
?
[Raw transfer]




ANP_A_3(2VPQ)
?
[Raw transfer]




ADP_B_8(2J9G)
ACCC_ECOLI
[Raw transfer]




ADP_A_8(3OUZ)
?
[Raw transfer]




AP2_A_2(2VQD)
ACCC_PSEAE
[Raw transfer]




ATP_B_4(1DV2)
ACCC_ECOLI
[Raw transfer]




ATF_A_4(2VR1)
ACCC_ECOLI
[Raw transfer]




LZK_B_4(2V59)
ACCC_ECOLI
[Raw transfer]




LZL_A_3(2V5A)
ACCC_ECOLI
[Raw transfer]




LZK_A_3(2V59)
ACCC_ECOLI
[Raw transfer]




OA4_A_3(2W6P)
ACCC_ECOLI
[Raw transfer]




JZL_A_3(3JZI)
ACCC_ECOLI
[Raw transfer]




L23_A_4(2W71)
ACCC_ECOLI
[Raw transfer]




JZL_B_4(3JZI)
ACCC_ECOLI
[Raw transfer]




OA2_B_5(2W6N)
ACCC_ECOLI
[Raw transfer]




LZJ_A_3(2V58)
ACCC_ECOLI
[Raw transfer]




L23_C_6(2W71)
ACCC_ECOLI
[Raw transfer]




LZJ_B_5(2V58)
ACCC_ECOLI
[Raw transfer]




GOL_A_5(3VA7)
?
[Raw transfer]




GOL_A_5(3VA7)
?
[Raw transfer]




OA2_A_3(2W6N)
ACCC_ECOLI
[Raw transfer]




JZK_B_4(3JZF)
ACCC_ECOLI
[Raw transfer]




GOL_A_7(3VA7)
?
[Raw transfer]




L21_A_3(2W6Z)
ACCC_ECOLI
[Raw transfer]




L22_A_3(2W70)
ACCC_ECOLI
[Raw transfer]




OA5_A_3(2W6Q)
ACCC_ECOLI
[Raw transfer]




OA5_B_5(2W6Q)
ACCC_ECOLI
[Raw transfer]




L22_B_5(2W70)
ACCC_ECOLI
[Raw transfer]




ADP_A_3(4RZQ)
ACCC_HAEIN
[Raw transfer]




OA1_A_3(2W6M)
ACCC_ECOLI
[Raw transfer]




OA1_B_5(2W6M)
ACCC_ECOLI
[Raw transfer]




OA3_C_5(2W6O)
ACCC_ECOLI
[Raw transfer]




OA3_A_3(2W6O)
ACCC_ECOLI
[Raw transfer]




ADP_B_9(3RUP)
ACCC_ECOLI
[Raw transfer]




ADP_B_7(3RV3)
ACCC_ECOLI
[Raw transfer]




ADP_A_3(3RV3)
ACCC_ECOLI
[Raw transfer]




21 PsiBlast_CBE 94.7068% -92 - C2 -2VPQ 7.4 ?
1 PsiBlast_PDB 93.9068% -92 - C2 -2VPQ 7.7 ?
110 HHSearch 93.4868% -89 - C2 -2VPQ 7.7 ?
40 PsiBlast_CBE 86.7453% -92 - C2 -2W6N 5.9 ACCC_ECOLI
51 PsiBlast_CBE 86.3153% -90 - C2 -3G8D 4.6 ACCC_ECOLI
111 HHSearch 86.0552% -89 - C2 -3OUZ 4.5 ?
32 PsiBlast_CBE 85.9553% -92 - C2 -2W71 6.5 ACCC_ECOLI
47 PsiBlast_CBE 85.9253% -90 - C2 -3G8C 5.2 ACCC_ECOLI
37 PsiBlast_CBE 85.9153% -91 - C2 -2W6Q 4.4 ACCC_ECOLI
12 PsiBlast_PDB 85.9053% -92 - C2 -2J9G 5.3 ACCC_ECOLI
31 PsiBlast_CBE 85.6653% -93 - C2 -2W71 6.7 ACCC_ECOLI
35 PsiBlast_CBE 85.5553% -90 - C2 -2W6Z - ACCC_ECOLI -
45 PsiBlast_CBE 85.4953% -91 - C2 -2V58 5.1 ACCC_ECOLI
53 PsiBlast_CBE 85.4353% -87 - C2 -3RV4 7.0 ACCC_ECOLI
36 PsiBlast_CBE 85.3853% -90 - C2 -2W6Z 4.3 ACCC_ECOLI
22 PsiBlast_CBE 85.3153% -95 - C2 -2C00 - ACCC_PSEAE -
33 PsiBlast_CBE 85.2453% -91 - C2 -2W70 3.3 ACCC_ECOLI
41 PsiBlast_CBE 85.1953% -91 - C2 -2W6M 4.5 ACCC_ECOLI
7 PsiBlast_PDB 85.1153% -89 - C2 -3JZI 8.2 ACCC_ECOLI
38 PsiBlast_CBE 84.9653% -90 - C2 -2W6Q 4.1 ACCC_ECOLI
19 PsiBlast_PDB 84.9553% -92 - C2 -2W6O 3.0 ACCC_ECOLI
24 PsiBlast_CBE 84.8953% -88 - C2 -3JZF 9.0 ACCC_ECOLI
23 PsiBlast_CBE 84.8953% -88 - C2 -3JZI 8.7 ACCC_ECOLI
15 PsiBlast_PDB 84.8353% -91 - C2 -2V59 4.2 ACCC_ECOLI
48 PsiBlast_CBE 84.8053% -90 - C2 -3G8C 5.3 ACCC_ECOLI
4 PsiBlast_PDB 84.7253% -88 - C2 -2VQD 6.2 ACCC_PSEAE
16 PsiBlast_PDB 84.6753% -90 - C2 -2V5A 4.6 ACCC_ECOLI
26 PsiBlast_CBE 84.6653% -88 - C2 -3RUP 6.9 ACCC_ECOLI
46 PsiBlast_CBE 84.5353% -92 - C2 -2J9G 5.5 ACCC_ECOLI
9 PsiBlast_PDB 84.5053% -91 - C2 -3RV3 7.3 ACCC_ECOLI
25 PsiBlast_CBE 84.4953% -90 - C2 -3RV3 6.3 ACCC_ECOLI
20 PsiBlast_PDB 84.4853% -90 - C2 -2W6P 3.4 ACCC_ECOLI
39 PsiBlast_CBE 84.4453% -92 - C2 -2W6O 3.5 ACCC_ECOLI
13 PsiBlast_PDB 84.4253% -92 - C2 -2VR1 3.8 ACCC_ECOLI
50 PsiBlast_CBE 84.2453% -89 - C2 -1DV2 6.5 ACCC_ECOLI
44 PsiBlast_CBE 84.2353% -90 - C2 -2V59 4.9 ACCC_ECOLI
14 PsiBlast_PDB 84.1953% -88 - C2 -2V58 5.4 ACCC_ECOLI
8 PsiBlast_PDB 84.1453% -88 - C2 -3RUP 6.8 ACCC_ECOLI
18 PsiBlast_PDB 83.9753% -89 - C2 -2W6N 5.6 ACCC_ECOLI
17 PsiBlast_PDB 83.8453% -89 - C2 -2W6M 4.4 ACCC_ECOLI
49 PsiBlast_CBE 83.7253% -87 - C2 -1DV2 4.0 ACCC_ECOLI
34 PsiBlast_CBE 83.5653% -90 - C2 -2W70 3.4 ACCC_ECOLI
2 PsiBlast_PDB 83.0855% -90 - C2 -4RZQ 3.6 ACCC_HAEIN
134 Fugue 72.5836% -89 - C2 -3VA7 3.0 ?
100 PsiBlast_CBE 71.6241% -93 - C2 -3VA7 2.1 ?
118 HHSearch 71.3840% -95 - C2 -3VA7 2.1 ?