@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1363: (2016-03-23 )
LQDLTLFLEQYKKVIDESLFKEINERNIEPRLKESMLYSIQAGGKRIRPMLVFATLQALKVNPLLGVKTATALEMIHTYSLIHDDLPAMDNDDYRRGKWTNHKVFGDATAILAGDALLTLAFSILAEDDNLSFETRIALINQISFSSGAEGMVGGQLADLEAENKQVTLEELSSIHARKTGELLIYAVTSAAKIAEADPEQTKRLRIFAENIGIGFQISDDILDVIGDETKMGKKTGADAFLNKSTYPGLLTLDGAKRALNEHVTIAKSALSGHDFDDEILLKLADLIALREN

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IPE_A_5(3PDE)
?
[Raw transfer]




IPE_D_7(3KRC)
?
[Raw transfer]




GPP_D_9(3KRP)
?
[Raw transfer]




IPR_A_9(1RQJ)
ISPA_ECOLI
[Raw transfer]




IPE_B_9(4LFG)
?
[Raw transfer]




IPR_B_11(1RQJ)
ISPA_ECOLI
[Raw transfer]




GRG_A_3(2J1P)
GGPPS_SINAL
[Raw transfer]




IPE_A_4(4LFG)
?
[Raw transfer]




IPE_B_7(4LFE)
?
[Raw transfer]




GOL_C_15(3M9U)
?
[Raw transfer]




GOL_B_12(3M9U)
?
[Raw transfer]




DMA_A_6(4GP2)
?
[Raw transfer]




GOL_C_16(3M9U)
?
[Raw transfer]




RIS_B_12(1RQJ)
ISPA_ECOLI
[Raw transfer]




RIS_A_10(1RQJ)
ISPA_ECOLI
[Raw transfer]




RIS_A_10(1RQJ)
ISPA_ECOLI
[Raw transfer]




IPE_A_5(3KRC)
?
[Raw transfer]




IPE_A_4(3WJO)
?
[Raw transfer]




PPV_A_3(3NPK)
?
[Raw transfer]




DST_B_9(1RQI)
ISPA_ECOLI
[Raw transfer]




DST_D_6(3OAC)
?
[Raw transfer]




DST_A_10(1RQI)
ISPA_ECOLI
[Raw transfer]




IPE_A_4(4LLT)
?
[Raw transfer]




DST_D_11(3OAB)
?
[Raw transfer]




IPE_B_9(4LLT)
?
[Raw transfer]




GST_A_4(4LLS)
?
[Raw transfer]




IPE_B_7(3OYR)
?
[Raw transfer]




GST_B_9(4LLS)
?
[Raw transfer]




DST_D_11(3KRF)
?
[Raw transfer]




IPE_D_24(3Q1O)
?
[Raw transfer]




IPE_C_18(3Q1O)
?
[Raw transfer]




IPE_A_3(4LFE)
?
[Raw transfer]




IPE_A_7(3Q1O)
?
[Raw transfer]




IPE_B_13(3Q1O)
?
[Raw transfer]




IPE_A_6(3PDE)
?
[Raw transfer]




IPE_A_5(3KRO)
?
[Raw transfer]




DST_D_11(3KRO)
?
[Raw transfer]




IPE_D_22(3PDE)
?
[Raw transfer]




IPE_A_6(3PDE)
?
[Raw transfer]




IPE_C_15(3PDE)
?
[Raw transfer]




IPE_B_13(3PDE)
?
[Raw transfer]




POP_A_3(3OYR)
?
[Raw transfer]




PPV_A_5(3KRF)
?
[Raw transfer]




DST_A_6(3OAB)
?
[Raw transfer]




2DE_D_13(3AQC)
HEXB_MICLU
[Raw transfer]




2DE_B_8(3AQC)
HEXB_MICLU
[Raw transfer]




6H6_A_4(3ZMB)
?
[Raw transfer]




PPV_A_5(3KRP)
?
[Raw transfer]




PPV_A_6(3KRF)
?
[Raw transfer]




6H6_B_6(3ZMB)
?
[Raw transfer]




6H6_B_8(3ZOU)
?
[Raw transfer]




1 PsiBlast_PDB 97.5852% -87 - C1 -1RTR - ? -
108 HHSearch 97.5351% -87 - C1 -1RTR - ? -
36 PsiBlast_CBE 95.1743% -80 - C1 -3TS7 - ? -
16 PsiBlast_PDB 92.8143% -79 - C1 -3TS7 - ? -
101 HHSearch 92.8044% -83 - C1 -3TS7 - ? -
38 PsiBlast_CBE 90.4345% -70 - C1 -1RQJ 4.9 ISPA_ECOLI
21 PsiBlast_CBE 90.4145% -69 - C1 -4LFG 5.2 ?
103 HHSearch 90.2141% -73 - C1 -3PDE 3.3 ?
37 PsiBlast_CBE 90.1745% -72 - C1 -1RQI 3.1 ISPA_ECOLI
17 PsiBlast_PDB 89.9845% -71 - C1 -1RQI 3.4 ISPA_ECOLI
2 PsiBlast_PDB 89.8945% -84 - C1 -4LFE 3.2 ?
104 HHSearch 89.8040% -80 - C1 -3LSN - ? -
106 HHSearch 89.7545% -61 - C1 -1RQJ 4.0 ISPA_ECOLI
18 PsiBlast_PDB 89.4545% -69 - C1 -1RQJ 4.8 ISPA_ECOLI
22 PsiBlast_CBE 89.3145% -69 - C1 -4LFE 5.1 ?
28 PsiBlast_CBE 89.1440% -83 - C1 -4KKM - ? -
8 PsiBlast_PDB 88.7240% -84 - C1 -4KKM - ? -
26 PsiBlast_CBE 88.7043% -75 - C1 -3M9U 3.0 ?
3 PsiBlast_PDB 88.4845% -68 - C1 -4LFG 5.4 ?
5 PsiBlast_PDB 88.0343% -71 - C1 -3M9U - ? -
111 HHSearch 87.4240% -79 - C1 -2J1P 7.8 GGPPS_SINAL
6 PsiBlast_PDB 87.3043% -70 - C1 -3PDE 5.0 ?
23 PsiBlast_CBE 87.0943% -70 - C1 -3PDE 3.0 ?
24 PsiBlast_CBE 86.9643% -71 - C1 -3PDE 3.4 ?
25 PsiBlast_CBE 86.1843% -70 - C1 -3PDE 3.2 ?
27 PsiBlast_CBE 86.0443% -71 - C1 -3M9U 2.6 ?
45 PsiBlast_CBE 84.6542% -86 - C1 -3ZMB 2.8 ?
46 PsiBlast_CBE 84.4242% -84 - C1 -3ZMB 3.6 ?
44 PsiBlast_CBE 84.3142% -87 - C1 -3ZOU 3.0 ?
14 PsiBlast_PDB 83.6642% -79 - C1 -3OAB 2.6 ?
12 PsiBlast_PDB 83.6042% -78 - C1 -3KRO 3.3 ?
11 PsiBlast_PDB 83.4642% -77 - C1 -3KRF 3.3 ?
13 PsiBlast_PDB 83.4342% -76 - C1 -3KRP 3.4 ?
10 PsiBlast_PDB 83.3542% -79 - C1 -3KRC 2.8 ?
32 PsiBlast_CBE 82.6042% -65 - C1 -3KRO 3.0 ?
31 PsiBlast_CBE 82.1742% -74 - C1 -3KRP 4.6 ?
34 PsiBlast_CBE 82.1242% -77 - C1 -3KRC 3.7 ?
30 PsiBlast_CBE 82.0342% -63 - C1 -3OAB 2.8 ?
33 PsiBlast_CBE 81.5142% -64 - C1 -3KRF 2.9 ?
29 PsiBlast_CBE 81.3842% -61 * C1 *3OAC 2.8 ?
115 HHSearch 77.9735% -64 - C1 -3NPK 3.5 ?
50 PsiBlast_CBE 76.4536% -53 - C1 -3Q1O 3.9 ?
52 PsiBlast_CBE 76.2736% -61 - C1 -3Q1O 4.0 ?
53 PsiBlast_CBE 76.1636% -60 - C1 -3Q1O 4.1 ?
51 PsiBlast_CBE 75.8836% -61 - C1 -3Q1O 3.9 ?
41 PsiBlast_CBE 75.7443% -44 - C1 -4LLT 3.8 ?
42 PsiBlast_CBE 75.6543% -48 - C1 -4LLS 5.2 ?
40 PsiBlast_CBE 75.5743% -46 - C1 -4LLT 3.4 ?
20 PsiBlast_PDB 75.1943% -47 - C1 -4LLS 5.7 ?
64 PsiBlast_CBE 66.4331% -44 - C1 -3AQC 4.0 HEXB_MICLU
65 PsiBlast_CBE 64.7331% -38 - C1 -3AQC 3.4 HEXB_MICLU
63 PsiBlast_CBE 62.6732% -47 - C1 -3OYR 3.4 ?
61 PsiBlast_CBE 59.6633% -62 - C1 -3WJO 2.5 ?
68 PsiBlast_CBE 58.0431% -36 - C1 -4GP2 3.7 ?