@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1364: (2016-03-24 )
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_A_5(1C9O)
CSPB_BACCL
[Raw transfer]




NACID_U_3(3TS2)
LN28A_MOUSE
[Raw transfer]

-

TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




4 PsiBlast_PDB 87.1275% -89 - C4 -1CSQ - CSPB_BACSU -
3 PsiBlast_PDB 86.2675% -80 - C4 -1CSP - CSPB_BACSU -
10 PsiBlast_PDB 86.2570% -93 - C4 -1HZC - CSPB_BACCL -
56 HHSearch 85.5468% -93 - C4 -1C9O 2.1 CSPB_BACCL
12 PsiBlast_PDB 85.2277%-117 - C4 -2I5L - CSPB_BACSU -
11 PsiBlast_PDB 84.8873% -98 - C4 -2I5M - CSPB_BACSU -
14 PsiBlast_PDB 84.8169% -91 - C4 -1I5F - CSPB_BACCL -
9 PsiBlast_PDB 84.7170% -90 - C4 -1HZ9 - CSPB_BACCL -
18 PsiBlast_PDB 84.4964%-106 - C4 -3A0J - ? -
13 PsiBlast_PDB 84.3069% -95 - C4 -1HZA - CSPB_BACCL -
21 PsiBlast_CBE 84.2175% -86 - C4 -3PF5 - CSPB_BACSU -
15 PsiBlast_PDB 84.1969% -95 - C4 -1C9O 2.6 CSPB_BACCL
8 PsiBlast_PDB 83.9275% -87 - C4 -3PF5 - CSPB_BACSU -
25 PsiBlast_CBE 83.3569% -90 - C4 -1HZB - CSPB_BACCL -
17 PsiBlast_PDB 83.1369% -93 - C4 -1HZB - CSPB_BACCL -
20 PsiBlast_PDB 83.0968%-130 - C4 -1MJC - CSPA_ECOLI -
7 PsiBlast_PDB 83.0475% -87 - C4 -3PF4 - CSPB_BACSU -
22 PsiBlast_CBE 83.0175% -83 - C4 -3PF4 - CSPB_BACSU -
1 PsiBlast_PDB 82.8275% -93 - C4 -2ES2 - CSPB_BACSU -
59 HHSearch 82.2564% -88 - C4 -3A0J - ? -
71 HHSearch 71.4541% -89 * C4 *3TS2 12.0 LN28A_MOUSE