@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1372: (2016-03-24 )
MTLKEAGLTEDKLIKMYETMLMARRLDERMWLLNRSGKIPFTISGQGQETAQIGAAFAFDLDKDYALPYYRDLAVVLAFGMTAKDIMLSAFAKAEDPNSGGRQMPAHFGQKSNRIVTQSSPVTTQFPHAAGIGLAAKMAGDEIAIYASTGEGSSNQGDFHEGINFASVHKLPVVFVIHNNQYAISVPASKQYAAEKLSDRAIGYGIPGERVDGTNMGEVYAAFKRAADRARNGEGPTLIETVSYRFTPHSSDDDDSSYRSREEVNEAKGKDPLTIFQTELLEEGYLTEEKIAEIEKNIAKEVNEATDYAESAAYAEPESSLLYVYDEEANS

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

THW_A_4(2BEW)
ODBA_HUMAN
[Raw transfer]




THY_A_4(2BEV)
ODBA_HUMAN
[Raw transfer]




THV_A_6(2BEU)
ODBA_HUMAN
[Raw transfer]




TDP_A_5(1OLX)
ODBA_HUMAN
[Raw transfer]




WWF_A_4(1WCI)
ODBA_HUMAN
[Raw transfer]




TZD_A_3(2BFF)
ODBA_HUMAN
[Raw transfer]




TDP_A_6(1DTW)
ODBA_HUMAN
[Raw transfer]




TDP_A_6(1U5B)
ODBA_HUMAN
[Raw transfer]




TDP_A_6(1DTW)
ODBA_HUMAN
[Raw transfer]




TDP_A_6(2BFB)
ODBA_HUMAN
[Raw transfer]




TDP_A_7(1X7Z)
ODBA_HUMAN
[Raw transfer]




TZD_A_5(2BFC)
ODBA_HUMAN
[Raw transfer]




TDP_A_6(2BFE)
ODBA_HUMAN
[Raw transfer]




TDP_A_10(1V11)
ODBA_HUMAN
[Raw transfer]




TDP_A_3(1V1M)
ODBA_HUMAN
[Raw transfer]




TDP_A_7(1X7Y)
ODBA_HUMAN
[Raw transfer]




TDP_A_7(1X7W)
ODBA_HUMAN
[Raw transfer]




TDP_A_7(1X7X)
ODBA_HUMAN
[Raw transfer]




TDP_A_9(1V16)
ODBA_HUMAN
[Raw transfer]




TDP_A_7(1X80)
ODBA_HUMAN
[Raw transfer]




TDP_A_5(1OLU)
ODBA_HUMAN
[Raw transfer]




67 HHSearch 96.0738% -52 - C5 -1UMD - ODBA_THET8 -
4 PsiBlast_PDB 95.3339% -52 - C5 -1UMD - ODBA_THET8 -
2 PsiBlast_PDB 95.1039% -52 - C5 -1UMB - ODBA_THET8 -
21 PsiBlast_CBE 94.9039% -53 - C5 -1UMD - ODBA_THET8 -
23 PsiBlast_CBE 94.1939% -54 - C5 -1UMB - ODBA_THET8 -
22 PsiBlast_CBE 94.0339% -55 - C5 -1UMC - ODBA_THET8 -
3 PsiBlast_PDB 94.0339% -54 - C5 -1UMC - ODBA_THET8 -
55 Fugue 93.0435% -62 - C5 -1DTW 5.4 ODBA_HUMAN
12 PsiBlast_PDB 91.8436% -61 - C5 -1U5B 6.8 ODBA_HUMAN
34 PsiBlast_CBE 91.4938% -55 - C5 -3DVA - ODPA_GEOSE -
24 PsiBlast_CBE 91.3139% -59 - C5 -1UM9 - ODBA_THET8 -
31 PsiBlast_CBE 91.0738% -57 - C5 -1W85 - ODPA_GEOSE -
30 PsiBlast_CBE 90.5138% -59 - C5 -3DUF - ODPA_GEOSE -
13 PsiBlast_PDB 90.4736% -61 - C5 -1WCI 7.5 ODBA_HUMAN
8 PsiBlast_PDB 90.3638% -54 - C5 -3DVA - ODPA_GEOSE -
7 PsiBlast_PDB 90.3638% -59 - C5 -1W85 - ODPA_GEOSE -
19 PsiBlast_PDB 90.3136% -59 - C5 -1X7Z 6.6 ODBA_HUMAN
68 HHSearch 90.2137% -59 * C5 *1W85 - ODPA_GEOSE -
43 PsiBlast_CBE 90.1236% -59 - C5 -2BFF 6.5 ODBA_HUMAN
1 PsiBlast_PDB 89.9739% -60 - C5 -1UM9 - ODBA_THET8 -
10 PsiBlast_PDB 89.8136% -63 - C5 -1DTW 5.4 ODBA_HUMAN
15 PsiBlast_PDB 89.6936% -59 - C5 -2BEV 7.5 ODBA_HUMAN
16 PsiBlast_PDB 89.3836% -60 - C5 -2BEW 8.2 ODBA_HUMAN
11 PsiBlast_PDB 89.3036% -58 - C5 -1OLX 6.3 ODBA_HUMAN
40 PsiBlast_CBE 88.8536% -65 - C5 -1X7X 5.9 ODBA_HUMAN
14 PsiBlast_PDB 88.5936% -58 - C5 -2BEU 7.2 ODBA_HUMAN
20 PsiBlast_PDB 88.1236% -65 - C5 -1X80 5.8 ODBA_HUMAN
17 PsiBlast_PDB 87.9436% -63 - C5 -1X7Y 5.8 ODBA_HUMAN
45 PsiBlast_CBE 87.7836% -66 - C5 -1OLU 6.0 ODBA_HUMAN
18 PsiBlast_PDB 87.6536% -63 - C5 -1X7W 6.1 ODBA_HUMAN
47 PsiBlast_CBE 87.2735% -63 - C5 -2BFB 6.3 ODBA_HUMAN
50 PsiBlast_CBE 86.6435% -63 - C5 -1V1M 6.1 ODBA_HUMAN
49 PsiBlast_CBE 86.4635% -65 - C5 -1V11 5.9 ODBA_HUMAN
51 PsiBlast_CBE 86.1735% -64 - C5 -2BFE 5.2 ODBA_HUMAN
46 PsiBlast_CBE 85.4935% -63 - C5 -1V16 6.1 ODBA_HUMAN
48 PsiBlast_CBE 84.5235% -63 - C5 -2BFC 5.9 ODBA_HUMAN