@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1420: (2016-03-24 )
MNNLQTKFPHIAIKLNEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRGVILHLDLLQTIERNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGALHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLALEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLKHAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGEDK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_B_2(1HSK)
MURB_STAAU
[Raw transfer]




FAD_B_2(1HSK)
MURB_STAAU
[Raw transfer]




FAD_B_2(1HSK)
MURB_STAAU
[Raw transfer]




FAD_A_2(3TX1)
MURB_LISMO
[Raw transfer]




FAD_A_2(3TX1)
MURB_LISMO
[Raw transfer]




FAD_A_2(4PYT)
MURB_BACLD
[Raw transfer]




EPU_C_3(2GQU)
MURB_THET8
[Raw transfer]




EPU_C_3(1UXY)
?
[Raw transfer]




FAD_B_2(1HSK)
MURB_STAAU
[Raw transfer]




33 HHSearch 97.80100%-115 - C2 -3TX1 13.9 MURB_LISMO
1 PsiBlast_PDB 97.80100%-115 - C2 -3TX1 13.9 MURB_LISMO
50 Fugue 89.3558%-108 - C2 -1HSK 14.1 MURB_STAAU
2 PsiBlast_PDB 89.2359%-112 - C2 -1HSK 14.1 MURB_STAAU
34 HHSearch 89.0159%-109 - C2 -1HSK 14.1 MURB_STAAU
3 PsiBlast_PDB 80.4441%-101 - C2 -4PYT 14.2 MURB_BACLD
6 PsiBlast_PDB 73.5428% -86 - C2 -3I99 - MURB_VIBCH -
30 HHSearch 73.2532% -89 - C2 -3I99 - MURB_VIBCH -
31 HHSearch 72.1828% -88 - C2 -1UXY - MURB_ECOLI -
7 PsiBlast_PDB 70.6425% -89 - C2 -4JAY - MURB_PSEAE -
8 PsiBlast_PDB 70.4225% -88 - C2 -4JB1 - MURB_PSEAE -
9 PsiBlast_PDB 69.8027% -89 - C2 -2Q85 - MURB_ECOLI -
12 PsiBlast_PDB 69.6727% -88 - C2 -2MBR - MURB_ECOLI -
11 PsiBlast_PDB 69.5427% -91 - C2 -1MBT - MURB_ECOLI -
13 PsiBlast_PDB 69.4826% -87 - C2 -1UXY - MURB_ECOLI -
10 PsiBlast_PDB 69.4427% -85 - C2 -1MBB - MURB_ECOLI -
32 HHSearch 69.1037% -76 - C2 -2GQT - MURB_THET8 -
4 PsiBlast_PDB 66.9236% -80 - C2 -2GQT - MURB_THET8 -
5 PsiBlast_PDB 66.6436% -80 - C2 -2GQU 5.6 MURB_THET8
52 Fugue 55.3671% -95 - C2 -1HSK 3.1 MURB_STAAU