Study : Lmo1429 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 4 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: BNG_B_14(3RLB) / Model_16(3RLB/B) = [3.2] Download730.4155.20MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGLARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK
Complex: BGL_A_6(4TKR) / Model_1(4TKR/A) = [3.2] Download982.2065.00MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGLARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK
Complex: BNG_A_3(3RLB) / Model_23(3RLB/A) = [4.1] Download906.2546.44MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGLARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK
Complex: BNG_A_3(3RLB) / Model_17(3RLB/A) = [4.1] Download998.5146.44MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGLARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK
Consensus
[pKd Mean = 3.65]
-904
(s=106)
53
(s=7)
MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGLARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK