@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1429: (2016-03-24 )
MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGLARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BGL_A_6(4TKR)
?
[Raw transfer]




BNG_B_14(3RLB)
?
[Raw transfer]




PEG_B_23(4MHW)
?
[Raw transfer]




PEG_B_25(4N4D)
?
[Raw transfer]




BNG_A_3(3RLB)
?
[Raw transfer]




BNG_A_3(3RLB)
?
[Raw transfer]




BGL_B_19(4TKR)
?
[Raw transfer]




9 PsiBlast_CBE 97.8699%-176 - C1 -4TKR 2.8 ?
1 PsiBlast_PDB 96.7599%-175 - C1 -4TKR 3.2 ?
11 PsiBlast_CBE 74.4237%-167 - C1 -4MES - ? -
16 PsiBlast_CBE 74.3437%-165 - C1 -3RLB 3.2 ?
4 PsiBlast_PDB 74.0637%-163 - C1 -3RLB - ? -
7 PsiBlast_PDB 73.6937%-161 - C1 -4POP - THIT_LACLM -
2 PsiBlast_PDB 73.5237%-161 - C1 -4MES - ? -
6 PsiBlast_PDB 73.3937%-167 - C1 -4MUU - ? -
8 PsiBlast_PDB 73.1837%-166 - C1 -4POV - THIT_LACLM -
15 PsiBlast_CBE 72.9737%-163 - C1 -4MHW 2.5 ?
10 PsiBlast_CBE 72.8537%-164 - C1 -4N4D 2.3 ?
5 PsiBlast_PDB 72.7737%-161 - C1 -4MHW - ? -
13 PsiBlast_CBE 72.7637%-161 - C1 -4POP - THIT_LACLM -
14 PsiBlast_CBE 72.5137%-166 - C1 -4MUU - ? -
12 PsiBlast_CBE 72.4637%-163 - C1 -4POV - THIT_LACLM -
3 PsiBlast_PDB 72.4437%-159 - C1 -4N4D - ? -
17 HHSearch 70.2534%-166 - C1 -3RLB 4.1 ?
23 Fugue 69.7334%-163 * C1 *3RLB 4.1 ?
29 Fugue 55.4519%-145 - C1 -3P5N - RIBU_STAAH -
25 Fugue 54.6122%-219 - C1 -1Q77 - Y178_AQUAE -