Study : Lmo1437 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: 11C_A_3(3PWS) / Model_6(3PWS/A) = [3.4] Download550.414.36MTKSYHVAVVGATGAVGTQMIELLEEAATFKIKQVSFLSSIRSAGKKLSFRGEEVTIQEATPESFEGVDIALFSAGGSVSKALAKEAVKRGAIVIDNTSAYRMDPTVPLVVPEVNEKALFSHNGIIANPNCSTIQMVAALEPIREAFGLNRIIVSTYQAVSGSGVSAIQELKDGSKAVLDNKEFTPQIMPVKGDKKHYPIAFNALPQIDVFTENDYTYEEMKMINETKKIMEDNTIKVSATCVRIPVVSGHSESVYIEVDKEGITAKEIQNALKNAPGIVLEDDPANQVYPQAVQAAGKKEVFVGRIRADIDDPKGFHMWIVSDNLLKGAAWNSIQIAESLVKLAII
Complex: 11C_B_6(3PWS) / Model_36(3PWS/B) = [3.4] Download525.053.00MTKSYHVAVVGATGAVGTQMIELLEEAATFKIKQVSFLSSIRSAGKKLSFRGEEVTIQEATPESFEGVDIALFSAGGSVSKALAKEAVKRGAIVIDNTSAYRMDPTVPLVVPEVNEKALFSHNGIIANPNCSTIQMVAALEPIREAFGLNRIIVSTYQAVSGSGVSAIQELKDGSKAVLDNKEFTPQIMPVKGDKKHYPIAFNALPQIDVFTENDYTYEEMKMINETKKIMEDNTIKVSATCVRIPVVSGHSESVYIEVDKEGITAKEIQNALKNAPGIVLEDDPANQVYPQAVQAAGKKEVFVGRIRADIDDPKGFHMWIVSDNLLKGAAWNSIQIAESLVKLAII
Complex: 12T_B_13(3PYX) / Model_33(3PYX/B) = [3.6] Download707.956.46MTKSYHVAVVGATGAVGTQMIELLEEAATFKIKQVSFLSSIRSAGKKLSFRGEEVTIQEATPESFEGVDIALFSAGGSVSKALAKEAVKRGAIVIDNTSAYRMDPTVPLVVPEVNEKALFSHNGIIANPNCSTIQMVAALEPIREAFGLNRIIVSTYQAVSGSGVSAIQELKDGSKAVLDNKEFTPQIMPVKGDKKHYPIAFNALPQIDVFTENDYTYEEMKMINETKKIMEDNTIKVSATCVRIPVVSGHSESVYIEVDKEGITAKEIQNALKNAPGIVLEDDPANQVYPQAVQAAGKKEVFVGRIRADIDDPKGFHMWIVSDNLLKGAAWNSIQIAESLVKLAII
Complex: 3JM_A_7(4R54) / Model_17(4R54/A) = [3.6] Download1116.7412.39MTKSYHVAVVGATGAVGTQMIELLEEAATFKIKQVSFLSSIRSAGKKLSFRGEEVTIQEATPESFEGVDIALFSAGGSVSKALAKEAVKRGAIVIDNTSAYRMDPTVPLVVPEVNEKALFSHNGIIANPNCSTIQMVAALEPIREAFGLNRIIVSTYQAVSGSGVSAIQELKDGSKAVLDNKEFTPQIMPVKGDKKHYPIAFNALPQIDVFTENDYTYEEMKMINETKKIMEDNTIKVSATCVRIPVVSGHSESVYIEVDKEGITAKEIQNALKNAPGIVLEDDPANQVYPQAVQAAGKKEVFVGRIRADIDDPKGFHMWIVSDNLLKGAAWNSIQIAESLVKLAII
Complex: 3JN_A_9(4R5H) / Model_18(4R5H/A) = [3.9] Download1102.453.30MTKSYHVAVVGATGAVGTQMIELLEEAATFKIKQVSFLSSIRSAGKKLSFRGEEVTIQEATPESFEGVDIALFSAGGSVSKALAKEAVKRGAIVIDNTSAYRMDPTVPLVVPEVNEKALFSHNGIIANPNCSTIQMVAALEPIREAFGLNRIIVSTYQAVSGSGVSAIQELKDGSKAVLDNKEFTPQIMPVKGDKKHYPIAFNALPQIDVFTENDYTYEEMKMINETKKIMEDNTIKVSATCVRIPVVSGHSESVYIEVDKEGITAKEIQNALKNAPGIVLEDDPANQVYPQAVQAAGKKEVFVGRIRADIDDPKGFHMWIVSDNLLKGAAWNSIQIAESLVKLAII
Consensus
[pKd Mean = 3.58]
-800
(s=260)
5
(s=3)
MTKSYHVAVVGATGAVGTQMIELLEEAATFKIKQVSFLSSIRSAGKKLSFRGEEVTIQEATPESFEGVDIALFSAGGSVSKALAKEAVKRGAIVIDNTSAYRMDPTVPLVVPEVNEKALFSHNGIIANPNCSTIQMVAALEPIREAFGLNRIIVSTYQAVSGSGVSAIQELKDGSKAVLDNKEFTPQIMPVKGDKKHYPIAFNALPQIDVFTENDYTYEEMKMINETKKIMEDNTIKVSATCVRIPVVSGHSESVYIEVDKEGITAKEIQNALKNAPGIVLEDDPANQVYPQAVQAAGKKEVFVGRIRADIDDPKGFHMWIVSDNLLKGAAWNSIQIAESLVKLAII