@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1437: (2016-03-24 )
MTKSYHVAVVGATGAVGTQMIELLEEAATFKIKQVSFLSSIRSAGKKLSFRGEEVTIQEATPESFEGVDIALFSAGGSVSKALAKEAVKRGAIVIDNTSAYRMDPTVPLVVPEVNEKALFSHNGIIANPNCSTIQMVAALEPIREAFGLNRIIVSTYQAVSGSGVSAIQELKDGSKAVLDNKEFTPQIMPVKGDKKHYPIAFNALPQIDVFTENDYTYEEMKMINETKKIMEDNTIKVSATCVRIPVVSGHSESVYIEVDKEGITAKEIQNALKNAPGIVLEDDPANQVYPQAVQAAGKKEVFVGRIRADIDDPKGFHMWIVSDNLLKGAAWNSIQIAESLVKLAII

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3JL_A_3(4R4J)
?
[Raw transfer]




3JN_A_9(4R5H)
?
[Raw transfer]




3JL_B_9(4R4J)
?
[Raw transfer]




11C_A_3(3PWS)
?
[Raw transfer]




12T_B_13(3PYX)
?
[Raw transfer]




3JM_A_7(4R54)
?
[Raw transfer]




NAP_B_11(4R4J)
?
[Raw transfer]




3GQ_A_6(4R3N)
?
[Raw transfer]




3GQ_A_4(4R3W)
?
[Raw transfer]




4NO_B_13(4R41)
?
[Raw transfer]




4NO_A_3(4R41)
?
[Raw transfer]




11C_B_6(3PWS)
?
[Raw transfer]




GOL_A_2(3VOS)
DHAS_MYCTU
[Raw transfer]




NAP_B_12(4R3N)
?
[Raw transfer]




NAP_A_10(4R5H)
?
[Raw transfer]




NAP_A_4(4R4J)
?
[Raw transfer]




NAP_A_5(4R3N)
?
[Raw transfer]




NAP_A_6(4R51)
?
[Raw transfer]




NAP_A_4(3PZB)
?
[Raw transfer]




NAP_A_3(3PYX)
?
[Raw transfer]




NAP_B_9(3PZB)
?
[Raw transfer]




NAP_B_9(3PYX)
?
[Raw transfer]




NAP_A_5(4R54)
?
[Raw transfer]




MLA_A_7(1YS4)
DHAS_METJA
[Raw transfer]




NAP_B_15(4R5H)
?
[Raw transfer]




NAP_B_9(4R54)
?
[Raw transfer]




NAP_B_15(4R51)
?
[Raw transfer]




NAP_B_9(3Q11)
?
[Raw transfer]




2RA_A_3(3PZB)
?
[Raw transfer]




2RA_B_8(3PZB)
?
[Raw transfer]




NAP_A_4(4R41)
?
[Raw transfer]




NAP_B_14(4R41)
?
[Raw transfer]




NAP_A_3(3Q11)
?
[Raw transfer]




A2P_B_7(3PWS)
?
[Raw transfer]




25A_B_10(3PWK)
?
[Raw transfer]




A2P_B_16(4R3W)
?
[Raw transfer]




A2P_A_8(4R3W)
?
[Raw transfer]




A2P_A_5(3PWS)
?
[Raw transfer]




25A_A_3(3PWK)
?
[Raw transfer]




CYS_A_2(3TZ6)
DHAS_MYCTU
[Raw transfer]




CYS_A_2(3TZ6)
DHAS_MYCTU
[Raw transfer]




16 PsiBlast_PDB 99.3563% -94 - C2 -4R51 10.7 ?
14 PsiBlast_PDB 98.9063% -93 - C2 -4R41 8.4 ?
13 PsiBlast_PDB 98.6163% -92 - C2 -4R3W 6.6 ?
27 PsiBlast_CBE 98.6063% -94 - C2 -4R3N 10.2 ?
12 PsiBlast_PDB 98.5563% -92 - C2 -4R3N 11.0 ?
17 PsiBlast_PDB 98.5063% -93 - C2 -4R54 10.9 ?
23 PsiBlast_CBE 98.3963% -94 - C2 -4R51 7.9 ?
37 PsiBlast_CBE 98.2463% -93 - C2 -3PWK 7.3 ?
15 PsiBlast_PDB 98.2163% -90 - C2 -4R4J 11.0 ?
41 PsiBlast_CBE 98.0963% -92 - C2 -2GZ2 - ? -
29 PsiBlast_CBE 98.0963% -94 - C2 -3Q1L - ? -
31 PsiBlast_CBE 98.0763% -93 - C2 -3Q11 7.2 ?
5 PsiBlast_PDB 98.0563% -94 - C2 -3PWK 6.1 ?
34 PsiBlast_CBE 98.0463% -95 - C2 -3PYL - ? -
39 PsiBlast_CBE 98.0063% -94 - C2 -2GZ3 - ? -
24 PsiBlast_CBE 97.9763% -93 - C2 -4R4J 10.2 ?
40 PsiBlast_CBE 97.7963% -91 - C2 -2GZ3 - ? -
33 PsiBlast_CBE 97.7563% -90 - C2 -3PYX 11.1 ?
38 PsiBlast_CBE 97.7363% -91 - C2 -2GZ3 - ? -
25 PsiBlast_CBE 97.7263% -93 - C2 -4R41 8.1 ?
21 PsiBlast_CBE 97.6163% -94 - C2 -4R5H 8.1 ?
22 PsiBlast_CBE 97.5663% -94 - C2 -4R54 7.1 ?
10 PsiBlast_PDB 97.5663% -92 - C2 -3Q11 9.1 ?
36 PsiBlast_CBE 97.5463% -93 - C2 -3PWS 6.5 ?
8 PsiBlast_PDB 97.5363% -90 - C2 -3PYX 10.5 ?
32 PsiBlast_CBE 97.4463% -93 - C2 -3PZB 11.2 ?
26 PsiBlast_CBE 97.3263% -94 - C2 -4R3W 5.4 ?
6 PsiBlast_PDB 97.2563% -95 - C2 -3PWS 6.4 ?
18 PsiBlast_PDB 97.2263% -90 - C2 -4R5H 10.2 ?
9 PsiBlast_PDB 96.9863% -94 - C2 -3PZB 10.8 ?
55 HHSearch 77.3142% -79 - C2 -3TZ6 4.0 DHAS_MYCTU
44 PsiBlast_CBE 77.1740% -79 - C2 -3TZ6 4.0 DHAS_MYCTU
43 PsiBlast_CBE 76.2340% -78 - C2 -3VOS 2.4 DHAS_MYCTU
66 HHSearch 68.4935% -76 - C2 -1YS4 2.9 DHAS_METJA