@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1451: (2016-03-24 )
MEIIKISPRGYCYGVIDAMVIAKNASLDPNLPRPIHILGMIVHNKHVTDAFESIGIYTVDGANREEILDKITTGTVIFTAHGVSPSVKAKAVAKGLTTIDATCPDVLHTYNLILEKQAAGYEIIYIGKKGHPEPEGAYGTAPDVVHLVETKADIDALSLLSDKIFVTNQTTMSKWDVADLMHYIKGKFPKAIQHQEICMATQVRQEAVALQAKDADLTIVVGDPRSNNTARLAQVSIEKAGTKAYRIADITELDIEWIKDAKKVAVTAGASTPTQLVREVLLFLEQFDAADKTTWKREHNQDFERILPKTKNKYMAEKRSQRLAHLKNGGS

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0O3_B_6(4EB3)
ISPH_ECOLI
[Raw transfer]




2E4_B_6(4MUX)
?
[Raw transfer]




2E5_B_6(4MUY)
?
[Raw transfer]




0CH_B_6(3UV6)
ISPH_ECOLI
[Raw transfer]




2E5_A_4(4MUY)
?
[Raw transfer]




2E6_B_6(4MV0)
?
[Raw transfer]




0CN_B_6(3UV7)
ISPH_ECOLI
[Raw transfer]




0CM_A_4(3UV3)
ISPH_ECOLI
[Raw transfer]




0CN_A_4(3UV7)
ISPH_ECOLI
[Raw transfer]




IPE_A_4(3KE9)
ISPH_ECOLI
[Raw transfer]




0JX_B_6(3UTC)
ISPH_ECOLI
[Raw transfer]




2E7_A_4(4MV5)
?
[Raw transfer]




DMA_A_4(3KEF)
ISPH_ECOLI
[Raw transfer]




0CM_B_6(3UV3)
ISPH_ECOLI
[Raw transfer]




0CG_A_4(3URK)
ISPH_ECOLI
[Raw transfer]




0CG_B_6(3URK)
ISPH_ECOLI
[Raw transfer]




2E7_B_6(4MV5)
?
[Raw transfer]




10D_B_6(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4MUX)
?
[Raw transfer]




SF4_A_3(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_B_6(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4MUX)
?
[Raw transfer]




SF4_B_5(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_A_4(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV7)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MUY)
?
[Raw transfer]




F3S_B_5(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MUY)
?
[Raw transfer]




F3S_A_3(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MV0)
?
[Raw transfer]




F3S_B_5(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MV0)
?
[Raw transfer]




F3S_B_6(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_B_9(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_A_4(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_B_4(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




42 PsiBlast_CBE 94.8736% -92 - C9 -3UTD 3.7 ISPH_ECOLI
31 PsiBlast_CBE 94.7036% -91 - C9 -4MUX 5.5 ?
23 PsiBlast_CBE 94.6836% -92 - C9 -3KEF 3.4 ISPH_ECOLI
32 PsiBlast_CBE 94.5936% -91 - C9 -4EB3 4.9 ISPH_ECOLI
45 PsiBlast_CBE 94.5836% -88 - C9 -4H4E 3.6 ISPH_ECOLI
41 PsiBlast_CBE 94.5636% -90 - C9 -3UV3 5.7 ISPH_ECOLI
40 PsiBlast_CBE 94.5336% -90 - C9 -3UV6 5.8 ISPH_ECOLI
44 PsiBlast_CBE 94.5236% -89 - C9 -3URK 5.1 ISPH_ECOLI
36 PsiBlast_CBE 94.5136% -90 - C9 -3UWM 3.6 ISPH_ECOLI
43 PsiBlast_CBE 94.4936% -90 - C9 -3UTC 5.1 ISPH_ECOLI
49 PsiBlast_CBE 94.4436% -89 - C9 -4H4C 4.6 ISPH_ECOLI
38 PsiBlast_CBE 94.3036% -91 - C9 -3UV7 5.3 ISPH_ECOLI
52 PsiBlast_CBE 94.1635% -91 - C9 -3SZU 3.6 ISPH_ECOLI
3 PsiBlast_PDB 94.1436% -89 - C9 -3KEF 5.2 ISPH_ECOLI
19 PsiBlast_PDB 94.0536% -90 - C9 -3UV3 5.6 ISPH_ECOLI
4 PsiBlast_PDB 94.0336% -87 - C9 -3KEL 3.4 ISPH_ECOLI
26 PsiBlast_CBE 94.0236% -90 - C9 -3ZGN 3.4 ISPH_ECOLI
33 PsiBlast_CBE 93.9736% -90 - C9 -3SZO 3.6 ISPH_ECOLI
8 PsiBlast_PDB 93.9436% -91 - C9 -4EB3 3.7 ISPH_ECOLI
27 PsiBlast_CBE 93.8636% -89 - C9 -3ZGL 3.5 ISPH_ECOLI
9 PsiBlast_PDB 93.8036% -89 - C9 -4MUY 5.6 ?
34 PsiBlast_CBE 93.7636% -90 - C9 -3SZL 3.6 ISPH_ECOLI
46 PsiBlast_CBE 93.7536% -90 - C9 -4H4E 3.5 ISPH_ECOLI
20 PsiBlast_PDB 93.6836% -89 - C9 -3UV6 3.6 ISPH_ECOLI
28 PsiBlast_CBE 93.6236% -90 - C9 -4MV5 6.2 ?
47 PsiBlast_CBE 93.6036% -91 - C9 -4H4D 3.6 ISPH_ECOLI
30 PsiBlast_CBE 93.5836% -93 - C9 -4MUY 5.7 ?
18 PsiBlast_PDB 93.4836% -88 - C9 -3UTD 3.5 ISPH_ECOLI
12 PsiBlast_PDB 93.4836% -94 - C9 -4MV5 6.3 ?
21 PsiBlast_CBE 93.4736% -89 - C9 -3KEM 3.4 ISPH_ECOLI
17 PsiBlast_PDB 93.4436% -89 - C9 -3UTC 3.5 ISPH_ECOLI
14 PsiBlast_PDB 93.3936% -88 - C9 -3SZL 3.6 ISPH_ECOLI
2 PsiBlast_PDB 93.3936% -91 - C9 -3KE9 5.4 ISPH_ECOLI
7 PsiBlast_PDB 93.3236% -89 - C9 -3ZGN 3.5 ISPH_ECOLI
10 PsiBlast_PDB 93.2936% -91 - C9 -4MV0 3.6 ?
37 PsiBlast_CBE 93.2636% -90 - C9 -3UWM 3.6 ISPH_ECOLI
5 PsiBlast_PDB 93.2136% -89 - C9 -3KEM 3.4 ISPH_ECOLI
50 PsiBlast_CBE 93.1836% -89 - C9 -4H4C 3.5 ISPH_ECOLI
11 PsiBlast_PDB 93.1836% -89 - C9 -4MUX 3.6 ?
35 PsiBlast_CBE 93.1636% -89 - C9 -3F7T 3.1 ISPH_ECOLI
15 PsiBlast_PDB 93.1136% -87 - C9 -3SZO 3.6 ISPH_ECOLI
48 PsiBlast_CBE 93.0936% -89 - C9 -4H4D 3.6 ISPH_ECOLI
39 PsiBlast_CBE 93.0636% -90 - C9 -3UV7 5.5 ISPH_ECOLI
1 PsiBlast_PDB 93.0636% -87 - C9 -3KE8 3.6 ISPH_ECOLI
29 PsiBlast_CBE 93.0536% -91 - C9 -4MV0 5.8 ?
16 PsiBlast_PDB 93.0036% -89 - C9 -3URK 5.3 ISPH_ECOLI
22 PsiBlast_CBE 92.7136% -90 - C9 -3KEL 3.4 ISPH_ECOLI
6 PsiBlast_PDB 92.7036% -89 - C9 -3ZGL 3.6 ISPH_ECOLI
25 PsiBlast_CBE 92.6336% -90 - C9 -3KE8 3.6 ISPH_ECOLI
13 PsiBlast_PDB 92.5636% -89 - C9 -3F7T 3.2 ISPH_ECOLI
24 PsiBlast_CBE 92.5436% -89 - C9 -3KE9 3.6 ISPH_ECOLI
56 PsiBlast_CBE 92.4535% -89 - C9 -3T0G 3.6 ISPH_ECOLI
53 PsiBlast_CBE 92.4335% -98 - C9 -3T0F 3.6 ISPH_ECOLI
54 PsiBlast_CBE 92.4235% -91 - C9 -3T0F 3.6 ISPH_ECOLI
51 PsiBlast_CBE 92.2135% -90 - C9 -3SZU 3.6 ISPH_ECOLI
55 PsiBlast_CBE 91.9235% -91 * C9 *3T0G 3.5 ISPH_ECOLI
59 Fugue 79.5930% -97 - C9 -3DNF 3.5 ISPH_AQUAE
69 HHSearch 78.8830% -92 - C9 -3DNF 3.5 ISPH_AQUAE
58 PsiBlast_CBE 75.4331% -87 - C9 -3DNF 3.5 ISPH_AQUAE
57 PsiBlast_CBE 75.3531% -85 - C9 -3DNF 3.6 ISPH_AQUAE