@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1463: (2016-03-25 )
MKENNFISLAKQAREFAYVPYSKFPVGAALVTKDDEVVLGCNIENASFGLTNCAERTAIFKAVSEGKRDFKQLVVVADTDGPVSPCGACRQVISEFCAPDMPVILTNLTGKTATVTVKELLPGAFTSEDML

Atome Classification :

(42 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TYU_D_13(2FR5)
CDD_MOUSE
[Raw transfer]




TYU_C_12(2FR5)
CDD_MOUSE
[Raw transfer]




CTN_A_10(2FR6)
CDD_MOUSE
[Raw transfer]




TYU_B_11(2FR5)
CDD_MOUSE
[Raw transfer]




BRD_A_5(1MQ0)
CDD_HUMAN
[Raw transfer]




CTN_D_13(2FR6)
CDD_MOUSE
[Raw transfer]




CTN_C_12(2FR6)
CDD_MOUSE
[Raw transfer]




THU_A_3(1UWZ)
CDD_BACSU
[Raw transfer]




BRD_B_6(1MQ0)
CDD_HUMAN
[Raw transfer]




TYU_A_10(2FR5)
CDD_MOUSE
[Raw transfer]




TYU_A_10(2FR5)
CDD_MOUSE
[Raw transfer]




THU_B_5(1UWZ)
CDD_BACSU
[Raw transfer]




DHZ_A_3(1CTT)
CDD_ECOLI
[Raw transfer]




THU_A_5(1UX1)
CDD_BACSU
[Raw transfer]




THU_C_10(1UX1)
CDD_BACSU
[Raw transfer]




THU_D_12(1UX1)
CDD_BACSU
[Raw transfer]




THU_B_5(1UX0)
CDD_BACSU
[Raw transfer]




THU_B_8(1UX1)
CDD_BACSU
[Raw transfer]




THU_A_5(1JTK)
CDD_BACSU
[Raw transfer]




THU_B_6(1JTK)
CDD_BACSU
[Raw transfer]




URD_A_10(1ZAB)
CDD_MOUSE
[Raw transfer]




URD_D_13(1ZAB)
CDD_MOUSE
[Raw transfer]




URI_B_11(2FR6)
CDD_MOUSE
[Raw transfer]




URD_B_11(1ZAB)
CDD_MOUSE
[Raw transfer]




URD_C_12(1ZAB)
CDD_MOUSE
[Raw transfer]




CTD_A_3(1ALN)
?
[Raw transfer]




EDO_A_6(3OJ6)
BSD_COCIM
[Raw transfer]




EDO_A_6(3R2N)
?
[Raw transfer]




EDO_B_8(3R2N)
?
[Raw transfer]




EDO_D_12(3R2N)
?
[Raw transfer]




MRD_D_13(3DMO)
?
[Raw transfer]




MRD_A_10(3DMO)
?
[Raw transfer]




EDO_A_6(3R2N)
?
[Raw transfer]




MRD_A_10(3DMO)
?
[Raw transfer]




MRD_B_11(3DMO)
?
[Raw transfer]




MRD_C_12(3DMO)
?
[Raw transfer]




EDO_C_10(3R2N)
?
[Raw transfer]




NH3_B_14(2FR6)
CDD_MOUSE
[Raw transfer]




59 Fugue 92.9863%-117 - C4 -1JTK 3.8 CDD_BACSU
21 PsiBlast_CBE 92.2163%-112 - C4 -1JTK 3.8 CDD_BACSU
23 PsiBlast_CBE 92.0563%-111 - C4 -1UWZ 3.1 CDD_BACSU
1 PsiBlast_PDB 92.0063%-112 - C4 -1JTK - CDD_BACSU -
72 HHSearch 91.8163%-112 - C4 -1UWZ 3.1 CDD_BACSU
3 PsiBlast_PDB 91.8163%-112 - C4 -1UWZ - CDD_BACSU -
2 PsiBlast_PDB 91.5763%-114 - C4 -1UX0 - CDD_BACSU -
22 PsiBlast_CBE 90.8463%-113 - C4 -1UX0 3.5 CDD_BACSU
71 HHSearch 90.5560%-111 - C4 -2D30 - ? -
5 PsiBlast_PDB 90.5560%-111 - C4 -2D30 - ? -
27 PsiBlast_CBE 89.6460%-112 - C4 -2D30 - ? -
26 PsiBlast_CBE 89.3862%-115 - C4 -1UX1 3.8 CDD_BACSU
24 PsiBlast_CBE 88.5262%-115 - C4 -1UX1 3.8 CDD_BACSU
25 PsiBlast_CBE 88.3562%-114 - C4 -1UX1 3.8 CDD_BACSU
4 PsiBlast_PDB 88.2462%-115 - C4 -1UX1 3.8 CDD_BACSU
73 HHSearch 86.6552%-111 - C4 -3DMO 3.3 ?
74 HHSearch 82.9848%-102 - C4 -2FR5 4.1 CDD_MOUSE
75 HHSearch 82.2740%-111 - C4 -1R5T - CDD_YEAST -
38 PsiBlast_CBE 79.8750%-107 - C4 -1ZAB 3.3 CDD_MOUSE
39 PsiBlast_CBE 79.8350%-102 - C4 -1ZAB 3.8 CDD_MOUSE
40 PsiBlast_CBE 79.7950%-105 - C4 -1ZAB 3.6 CDD_MOUSE
28 PsiBlast_CBE 79.7249%-107 - C4 -1MQ0 3.9 CDD_HUMAN
33 PsiBlast_CBE 79.5050%-103 - C4 -2FR6 3.7 CDD_MOUSE
6 PsiBlast_PDB 79.3149%-104 - C4 -1MQ0 3.8 CDD_HUMAN
10 PsiBlast_PDB 78.2750%-102 - C4 -2FR6 3.6 CDD_MOUSE
36 PsiBlast_CBE 78.1850%-101 - C4 -2FR5 3.9 CDD_MOUSE
32 PsiBlast_CBE 78.1450%-100 - C4 -2FR6 3.5 CDD_MOUSE
34 PsiBlast_CBE 78.1050%-104 - C4 -2FR6 4.0 CDD_MOUSE
9 PsiBlast_PDB 77.5350%-103 - C4 -2FR5 4.1 CDD_MOUSE
8 PsiBlast_PDB 77.5150%-102 - C4 -1ZAB 3.5 CDD_MOUSE
37 PsiBlast_CBE 77.1050%-102 - C4 -2FR5 4.0 CDD_MOUSE
35 PsiBlast_CBE 76.6750%-101 - C4 -2FR5 4.0 CDD_MOUSE
31 PsiBlast_CBE 76.1654%-124 - C4 -3DMO 2.9 ?
7 PsiBlast_PDB 75.8554%-123 - C4 -3DMO 3.2 ?
29 PsiBlast_CBE 75.0154%-122 - C4 -3DMO 3.1 ?
30 PsiBlast_CBE 74.9654%-122 - C4 -3DMO 3.1 ?
52 PsiBlast_CBE 66.5632% -98 - C4 -3R2N 3.8 ?
53 PsiBlast_CBE 64.4932% -96 - C4 -3R2N 2.4 ?
54 PsiBlast_CBE 64.3132% -95 - C4 -3R2N 3.8 ?
17 PsiBlast_PDB 62.4732%-100 - C4 -3R2N 3.6 ?
77 HHSearch 60.2234% -96 - C4 -3R2N 3.6 ?
78 HHSearch 52.1530% -87 - C4 -3OJ6 3.7 BSD_COCIM