@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1488: (2016-03-25 )
MKHKVGILGGTFDPPHLAHLHMAEEAKKQLELEKILFLPNKIPPHKHISGMASINERVEMLQLMIEGIDSFEIDTRELMRTGKSYTYDTMRDMIIEQPDTDFYFIIGGDMVEYLPKWYHIDDLVKMVTFVGVNRPLYQPEVPYDVVKIDMPKTTISSTEIRNDIEHAEAFLPEKVWSYIKEHQLYGKK

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_B_7(3MLB)
NADD_BACAC
[Raw transfer]




FMT_A_4(3MLB)
NADD_BACAC
[Raw transfer]




DND_D_11(3E27)
?
[Raw transfer]




NAD_H_8(1K4M)
NADD_ECOLI
[Raw transfer]




NXX_A_8(2QTR)
NADD_BACAC
[Raw transfer]




NXX_C_10(2QTR)
NADD_BACAC
[Raw transfer]




DND_I_9(1KAQ)
NADD_BACSU
[Raw transfer]




DND_B_7(3E27)
?
[Raw transfer]




DND_C_9(3E27)
?
[Raw transfer]




NXX_B_9(2QTR)
NADD_BACAC
[Raw transfer]




NXX_A_8(2QTR)
NADD_BACAC
[Raw transfer]




DND_L_12(1KAQ)
NADD_BACSU
[Raw transfer]




DND_A_5(3E27)
?
[Raw transfer]




DND_H_8(1KAQ)
NADD_BACSU
[Raw transfer]




DND_D_4(2H29)
NADD_STAAC
[Raw transfer]




DND_J_10(1KAQ)
NADD_BACSU
[Raw transfer]




DND_C_3(2H29)
NADD_STAAC
[Raw transfer]




DND_D_4(2H29)
NADD_STAAC
[Raw transfer]




DND_K_11(1KAQ)
NADD_BACSU
[Raw transfer]




NAD_F_6(1K4M)
NADD_ECOLI
[Raw transfer]




NAD_D_4(1K4M)
NADD_ECOLI
[Raw transfer]




NAD_D_4(1K4M)
NADD_ECOLI
[Raw transfer]




DND_G_7(1KAQ)
NADD_BACSU
[Raw transfer]




GOL_B_8(2QTM)
?
[Raw transfer]




GOL_A_6(2QTM)
?
[Raw transfer]




GOL_A_9(2QTN)
?
[Raw transfer]




NCN_B_5(2QTN)
?
[Raw transfer]




LJZ_A_5(3MLB)
NADD_BACAC
[Raw transfer]




LJZ_A_5(3MLB)
NADD_BACAC
[Raw transfer]




JJZ_A_3(3MLA)
NADD_BACAC
[Raw transfer]




NCN_A_6(1YUM)
NADD_PSEAE
[Raw transfer]




NCN_A_6(1YUM)
NADD_PSEAE
[Raw transfer]




CIT_E_5(1K4M)
NADD_ECOLI
[Raw transfer]




CIT_I_9(1K4M)
NADD_ECOLI
[Raw transfer]




DZ9_A_3(3HFJ)
?
[Raw transfer]




JJZ_A_3(3MLA)
NADD_BACAC
[Raw transfer]




DZ9_A_3(3HFJ)
?
[Raw transfer]




XE_A_5(1K4K)
NADD_ECOLI
[Raw transfer]




DMS_B_9(3MLA)
NADD_BACAC
[Raw transfer]




84 HHSearch 94.5849%-129 - C3 -2QTR 11.2 NADD_BACAC
22 PsiBlast_CBE 92.8948%-141 - C3 -3DV2 - ? -
34 PsiBlast_CBE 91.4548%-144 - C3 -3MLA 5.4 NADD_BACAC
7 PsiBlast_PDB 91.2748%-139 - C3 -2QTM 2.7 ?
35 PsiBlast_CBE 91.0248%-139 - C3 -3HFJ 5.3 ?
40 PsiBlast_CBE 90.9348%-131 - C3 -2QTM 2.7 ?
21 PsiBlast_CBE 90.6748%-135 - C3 -3DV2 - ? -
2 PsiBlast_PDB 90.5348%-132 - C3 -2QTR 11.3 NADD_BACAC
1 PsiBlast_PDB 90.4248%-136 - C3 -3DV2 - ? -
6 PsiBlast_PDB 90.3248%-140 - C3 -3MMX - NADD_BACAC -
37 PsiBlast_CBE 90.1748%-127 - C3 -3E27 11.1 ?
38 PsiBlast_CBE 90.1548%-128 - C3 -3E27 11.5 ?
32 PsiBlast_CBE 89.5248%-138 - C3 -3MMX - NADD_BACAC -
31 PsiBlast_CBE 89.5248%-145 - C3 -3MMX - NADD_BACAC -
30 PsiBlast_CBE 89.5248%-142 - C3 -3MMX - NADD_BACAC -
33 PsiBlast_CBE 89.3948%-139 - C3 -3MLB 5.8 NADD_BACAC
26 PsiBlast_CBE 89.1948%-148 - C3 -3MMX - NADD_BACAC -
29 PsiBlast_CBE 89.1548%-139 - C3 -3MMX - NADD_BACAC -
23 PsiBlast_CBE 89.1148%-139 - C3 -3DV2 - ? -
5 PsiBlast_PDB 88.9548%-137 - C3 -3MLB 6.1 NADD_BACAC
25 PsiBlast_CBE 88.8448%-125 - C3 -2QTR 11.3 NADD_BACAC
9 PsiBlast_PDB 88.7648%-126 - C3 -3E27 11.6 ?
24 PsiBlast_CBE 88.3848%-127 - C3 -2QTR 12.1 NADD_BACAC
36 PsiBlast_CBE 88.0748%-125 - C3 -3E27 11.2 ?
8 PsiBlast_PDB 88.0248%-131 - C3 -2QTN 2.0 ?
11 PsiBlast_PDB 87.8944%-119 - C3 -1KAQ 10.3 NADD_BACSU
4 PsiBlast_PDB 87.8948%-135 - C3 -3MLA 5.1 NADD_BACAC
3 PsiBlast_PDB 87.7148%-136 - C3 -3HFJ 5.1 ?
39 PsiBlast_CBE 87.5848%-128 * C3 *2QTN 4.7 ?
43 PsiBlast_CBE 86.8144%-123 - C3 -1KAQ 9.5 NADD_BACSU
44 PsiBlast_CBE 85.8744%-119 - C3 -1KAQ 9.3 NADD_BACSU
45 PsiBlast_CBE 83.0144%-115 - C3 -1KAQ 10.3 NADD_BACSU
42 PsiBlast_CBE 81.0644%-127 - C3 -1KAQ 8.4 NADD_BACSU
47 PsiBlast_CBE 80.5331%-117 - C3 -1K4M 8.6 NADD_ECOLI
41 PsiBlast_CBE 80.3344%-135 - C3 -1KAQ 6.6 NADD_BACSU
85 HHSearch 80.1031%-119 - C3 -1YUM 2.8 NADD_PSEAE
48 PsiBlast_CBE 79.6331%-116 - C3 -1K4M 8.9 NADD_ECOLI
16 PsiBlast_PDB 78.3531%-118 - C3 -1K4K 2.8 NADD_ECOLI
87 HHSearch 77.4336%-115 - C3 -2H29 10.4 NADD_STAAC
83 HHSearch 77.1535%-114 - C3 -1K4M 8.9 NADD_ECOLI
46 PsiBlast_CBE 76.8835%-118 - C3 -2H29 11.1 NADD_STAAC
17 PsiBlast_PDB 76.5331%-114 - C3 -1K4M 8.9 NADD_ECOLI
12 PsiBlast_PDB 76.3435%-119 - C3 -2H29 10.4 NADD_STAAC