@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1490: (2016-03-25 )
LEKYVVIGNPIRHSLSPAMQNRIFQELGMNAEYNSVLIEEDAFETEIKKLMDSGVRGFNITTPFKERILPFLDELDNLAAASGAVNTVLKKEDKWYGFNTDGKGYLEGLEEIRSITEDDSILITGAGGASKAIYLALSTHTDAKITVANRTTEKAIEMTKDNNNHHAITLEEAEKQLADFTIIIQTTSIGLEASKNKSPISLANVKQGTICSDIIYNPAETAFLKEAKKNGAITQNGLPMFVNQGALAFEIWTGIKPERSLMKEAVLEQLGGN

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SKM_A_2(3PHH)
AROE_HELPY
[Raw transfer]




DHK_A_5(2O7S)
DHQSD_ARATH
[Raw transfer]




SKM_A_2(3PHH)
AROE_HELPY
[Raw transfer]




DHK_A_3(3PHJ)
AROE_HELPY
[Raw transfer]




DHK_B_4(3PHJ)
AROE_HELPY
[Raw transfer]




SKM_B_6(2EV9)
AROE_THET8
[Raw transfer]




SKM_A_2(4FOS)
AROE_HELPY
[Raw transfer]




SKM_A_3(3PHI)
AROE_HELPY
[Raw transfer]




NAP_D_11(2HK9)
AROE_AQUAE
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




SKM_C_11(3TNL)
AROE_LISMO
[Raw transfer]




SKM_E_5(2GPT)
DHQSD_ARATH
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




SKM_B_8(2D5C)
AROE_THET8
[Raw transfer]




NAP_C_9(2HK9)
AROE_AQUAE
[Raw transfer]




QIC_A_3(3JYP)
AROE_CORGL
[Raw transfer]




SKM_A_3(4FQ8)
AROE_HELPY
[Raw transfer]




SKM_A_6(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_B_7(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_A_6(2O7S)
DHQSD_ARATH
[Raw transfer]




SKM_B_4(4FR5)
AROE_HELPY
[Raw transfer]




SKM_C_7(3PGJ)
AROE_VIBCH
[Raw transfer]




NAP_B_21(1NYT)
AROE_ECOLI
[Raw transfer]




SKM_A_3(4FR5)
AROE_HELPY
[Raw transfer]




SKM_C_8(3SEF)
AROE_VIBCH
[Raw transfer]




SKM_A_6(3TNL)
AROE_LISMO
[Raw transfer]




NDP_B_6(3PHI)
AROE_HELPY
[Raw transfer]




NAP_A_19(1NYT)
AROE_ECOLI
[Raw transfer]




SKM_D_8(3PGJ)
AROE_VIBCH
[Raw transfer]




NAP_A_19(1NYT)
AROE_ECOLI
[Raw transfer]




SKM_B_4(4FQ8)
AROE_HELPY
[Raw transfer]




GOL_A_2(2NLO)
AROE_CORGL
[Raw transfer]




SKM_A_3(3JYQ)
AROE_CORGL
[Raw transfer]




SKM_B_6(3PGJ)
AROE_VIBCH
[Raw transfer]




NAP_B_6(1NVT)
AROE_METJA
[Raw transfer]




NAP_D_23(1NYT)
AROE_ECOLI
[Raw transfer]




SKM_A_6(3TNL)
AROE_LISMO
[Raw transfer]




SKM_A_5(3PGJ)
AROE_VIBCH
[Raw transfer]




NAP_A_5(1NVT)
AROE_METJA
[Raw transfer]




NAP_A_7(2EV9)
AROE_THET8
[Raw transfer]




NAP_A_5(1NVT)
AROE_METJA
[Raw transfer]




NAP_A_5(2CY0)
AROE_THET8
[Raw transfer]




ATR_A_5(2HK9)
AROE_AQUAE
[Raw transfer]




NDP_B_6(3SEF)
AROE_VIBCH
[Raw transfer]




DTV_A_20(1NYT)
AROE_ECOLI
[Raw transfer]




1 PsiBlast_PDB 96.5445% -88 - C5 -3DON - AROE_STAEQ -
3 PsiBlast_PDB 95.6644% -86 - C5 -2EGG - AROE_GEOKA -
95 HHSearch 94.8544% -78 - C5 -2EGG - AROE_GEOKA -
2 PsiBlast_PDB 94.8445% -88 - C5 -3DOO - AROE_STAEQ -
6 PsiBlast_PDB 92.8037% -87 - C5 -2HK9 3.6 AROE_AQUAE
4 PsiBlast_PDB 92.0537% -86 - C5 -2HK7 - AROE_AQUAE -
23 PsiBlast_CBE 91.6337% -84 - C5 -2HK9 9.0 AROE_AQUAE
5 PsiBlast_PDB 91.2437% -87 - C5 -2HK8 - AROE_AQUAE -
24 PsiBlast_CBE 90.8737% -88 - C5 -2HK7 - AROE_AQUAE -
84 HHSearch 90.5144% -67 - C5 -3DON - AROE_STAEQ -
22 PsiBlast_CBE 90.3537% -82 - C5 -2HK9 8.8 AROE_AQUAE
21 PsiBlast_CBE 89.6037% -83 - C5 -2HK9 10.4 AROE_AQUAE
27 PsiBlast_CBE 89.2436% -71 - C5 -1NYT - AROE_ECOLI -
28 PsiBlast_CBE 88.6436% -69 - C5 -1NYT 6.9 AROE_ECOLI
26 PsiBlast_CBE 88.0136% -70 - C5 -1NYT 7.4 AROE_ECOLI
10 PsiBlast_PDB 87.2336% -67 - C5 -2CY0 8.2 AROE_THET8
11 PsiBlast_PDB 86.8336% -69 - C5 -2D5C 3.6 AROE_THET8
94 HHSearch 86.7437% -70 - C5 -2HK9 5.6 AROE_AQUAE
31 PsiBlast_CBE 86.6736% -64 - C5 -2CY0 - AROE_THET8 -
8 PsiBlast_PDB 86.6436% -70 - C5 -1NYT 8.0 AROE_ECOLI
29 PsiBlast_CBE 86.4636% -64 - C5 -2EV9 3.5 AROE_THET8
88 HHSearch 85.9738% -74 - C5 -1NVT 8.1 AROE_METJA
25 PsiBlast_CBE 85.8838% -71 - C5 -1NVT 7.6 AROE_METJA
12 PsiBlast_PDB 85.8636% -64 - C5 -2EV9 6.3 AROE_THET8
7 PsiBlast_PDB 85.5838% -73 - C5 -1NVT 8.1 AROE_METJA
87 HHSearch 84.9436% -70 - C5 -1NYT 8.0 AROE_ECOLI
30 PsiBlast_CBE 84.1936% -67 - C5 -2D5C 3.6 AROE_THET8
37 PsiBlast_CBE 83.9531% -65 - C5 -3PGJ 3.8 AROE_VIBCH
56 PsiBlast_CBE 82.1331% -70 - C5 -2NLO 2.9 AROE_CORGL
57 PsiBlast_CBE 81.9731% -71 - C5 -3JYQ 3.6 AROE_CORGL
47 PsiBlast_CBE 81.7232% -69 - C5 -3TNL 3.3 AROE_LISMO
58 PsiBlast_CBE 81.5031% -71 - C5 -3JYP 2.9 AROE_CORGL
17 PsiBlast_PDB 81.4432% -70 - C5 -3TNL 3.6 AROE_LISMO
91 HHSearch 81.1733% -68 - C5 -2O7S 7.1 DHQSD_ARATH
85 HHSearch 81.0436% -59 - C5 -2D5C 3.6 AROE_THET8
14 PsiBlast_PDB 79.9631% -61 - C5 -3PGJ 3.2 AROE_VIBCH
36 PsiBlast_CBE 79.6531% -59 - C5 -3PGJ 3.2 AROE_VIBCH
35 PsiBlast_CBE 79.3731% -58 - C5 -3SEF 7.4 AROE_VIBCH
81 HHSearch 79.2032% -62 * C5 *3TNL 3.5 AROE_LISMO
38 PsiBlast_CBE 78.2331% -58 - C5 -3PGJ 3.2 AROE_VIBCH
34 PsiBlast_CBE 77.7931% -73 - C5 -3SEF 2.5 AROE_VIBCH
50 PsiBlast_CBE 74.3231% -77 - C5 -2GPT 3.6 DHQSD_ARATH
63 PsiBlast_CBE 72.3331% -57 - C5 -4FQ8 3.5 AROE_HELPY
53 PsiBlast_CBE 70.6331% -58 - C5 -3PHI 5.7 AROE_HELPY
64 PsiBlast_CBE 69.3731% -51 - C5 -4FQ8 3.3 AROE_HELPY
51 PsiBlast_CBE 68.6631% -56 - C5 -3PHJ 4.0 AROE_HELPY
61 PsiBlast_CBE 68.6531% -52 - C5 -4FR5 3.3 AROE_HELPY
52 PsiBlast_CBE 68.4631% -55 - C5 -3PHJ 4.0 AROE_HELPY
60 PsiBlast_CBE 68.3331% -56 - C5 -4FOS 3.4 AROE_HELPY
54 PsiBlast_CBE 68.1831% -55 - C5 -3PHI 4.0 AROE_HELPY
62 PsiBlast_CBE 67.8131% -47 - C5 -4FR5 3.5 AROE_HELPY
55 PsiBlast_CBE 67.3731% -56 - C5 -3PHH 4.0 AROE_HELPY
93 HHSearch 66.3830% -48 - C5 -3PHH 4.0 AROE_HELPY