Study : Lmo1491 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C8_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C8_S1
Complex: GDP_A_3(3EC1) / Model_89(3EC1/A) = [5.1] Download970.0410.42LTEEVRCIGCGAVIQTEDPDKIGYAPKSSLNNEQVICKRCFRLKHYNEIQDVALTDDDFLRILNQISSKQALIVYVVDIFDFDGSWLPGLPRFAGSNPVLLVGNKEDVLPKSLKRDKLTRWMRTRAKEQGLAATDVVLVSAEKGHGFDTLLEKIDELRNGQDVYVVGCTNVGKSTLINRIIKQASGENNVITTSQFPGTTLDKIEIPLADGNVLVDTPGIINHHQMAHFIDTTTLKAITPKKEVKPAVFQLNEEQTLFLGALARLDYVSGGRKSLVVYVSNNLPIHRTKLEKAEALYEKQAGLVLQPPTEEDMKTLPKLVPYSFTVKEKADIVFSGLGWVTIPEGGAKVTAWVPEGVSATIRTSLV
Complex: GDP_A_3(3EC1) / Model_61(3EC1/A) = [5.1] Download982.4210.42LTEEVRCIGCGAVIQTEDPDKIGYAPKSSLNNEQVICKRCFRLKHYNEIQDVALTDDDFLRILNQISSKQALIVYVVDIFDFDGSWLPGLPRFAGSNPVLLVGNKEDVLPKSLKRDKLTRWMRTRAKEQGLAATDVVLVSAEKGHGFDTLLEKIDELRNGQDVYVVGCTNVGKSTLINRIIKQASGENNVITTSQFPGTTLDKIEIPLADGNVLVDTPGIINHHQMAHFIDTTTLKAITPKKEVKPAVFQLNEEQTLFLGALARLDYVSGGRKSLVVYVSNNLPIHRTKLEKAEALYEKQAGLVLQPPTEEDMKTLPKLVPYSFTVKEKADIVFSGLGWVTIPEGGAKVTAWVPEGVSATIRTSLV
Complex: GDP_B_4(3EC1) / Model_21(3EC1/B) = [5.1] Download1231.818.76LTEEVRCIGCGAVIQTEDPDKIGYAPKSSLNNEQVICKRCFRLKHYNEIQDVALTDDDFLRILNQISSKQALIVYVVDIFDFDGSWLPGLPRFAGSNPVLLVGNKEDVLPKSLKRDKLTRWMRTRAKEQGLAATDVVLVSAEKGHGFDTLLEKIDELRNGQDVYVVGCTNVGKSTLINRIIKQASGENNVITTSQFPGTTLDKIEIPLADGNVLVDTPGIINHHQMAHFIDTTTLKAITPKKEVKPAVFQLNEEQTLFLGALARLDYVSGGRKSLVVYVSNNLPIHRTKLEKAEALYEKQAGLVLQPPTEEDMKTLPKLVPYSFTVKEKADIVFSGLGWVTIPEGGAKVTAWVPEGVSATIRTSLV
Complex: GDP_A_3(3EC1) / Model_2(3EC1/A) = [5.1] Download1012.1110.42LTEEVRCIGCGAVIQTEDPDKIGYAPKSSLNNEQVICKRCFRLKHYNEIQDVALTDDDFLRILNQISSKQALIVYVVDIFDFDGSWLPGLPRFAGSNPVLLVGNKEDVLPKSLKRDKLTRWMRTRAKEQGLAATDVVLVSAEKGHGFDTLLEKIDELRNGQDVYVVGCTNVGKSTLINRIIKQASGENNVITTSQFPGTTLDKIEIPLADGNVLVDTPGIINHHQMAHFIDTTTLKAITPKKEVKPAVFQLNEEQTLFLGALARLDYVSGGRKSLVVYVSNNLPIHRTKLEKAEALYEKQAGLVLQPPTEEDMKTLPKLVPYSFTVKEKADIVFSGLGWVTIPEGGAKVTAWVPEGVSATIRTSLV
Complex: DGI_A_2(3H2Y) / Model_62(3H2Y/A) = [7.2] Download1130.8711.50LTEEVRCIGCGAVIQTEDPDKIGYAPKSSLNNEQVICKRCFRLKHYNEIQDVALTDDDFLRILNQISSKQALIVYVVDIFDFDGSWLPGLPRFAGSNPVLLVGNKEDVLPKSLKRDKLTRWMRTRAKEQGLAATDVVLVSAEKGHGFDTLLEKIDELRNGQDVYVVGCTNVGKSTLINRIIKQASGENNVITTSQFPGTTLDKIEIPLADGNVLVDTPGIINHHQMAHFIDTTTLKAITPKKEVKPAVFQLNEEQTLFLGALARLDYVSGGRKSLVVYVSNNLPIHRTKLEKAEALYEKQAGLVLQPPTEEDMKTLPKLVPYSFTVKEKADIVFSGLGWVTIPEGGAKVTAWVPEGVSATIRTSLV
Consensus
[pKd Mean = 5.52]
-1065
(s=100)
10
(s=0)
LTEEVRCIGCGAVIQTEDPDKIGYAPKSSLNNEQVICKRCFRLKHYNEIQDVALTDDDFLRILNQISSKQALIVYVVDIFDFDGSWLPGLPRFAGSNPVLLVGNKEDVLPKSLKRDKLTRWMRTRAKEQGLAATDVVLVSAEKGHGFDTLLEKIDELRNGQDVYVVGCTNVGKSTLINRIIKQASGENNVITTSQFPGTTLDKIEIPLADGNVLVDTPGIINHHQMAHFIDTTTLKAITPKKEVKPAVFQLNEEQTLFLGALARLDYVSGGRKSLVVYVSNNLPIHRTKLEKAEALYEKQAGLVLQPPTEEDMKTLPKLVPYSFTVKEKADIVFSGLGWVTIPEGGAKVTAWVPEGVSATIRTSLV