@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1491: (2016-03-25 )
LTEEVRCIGCGAVIQTEDPDKIGYAPKSSLNNEQVICKRCFRLKHYNEIQDVALTDDDFLRILNQISSKQALIVYVVDIFDFDGSWLPGLPRFAGSNPVLLVGNKEDVLPKSLKRDKLTRWMRTRAKEQGLAATDVVLVSAEKGHGFDTLLEKIDELRNGQDVYVVGCTNVGKSTLINRIIKQASGENNVITTSQFPGTTLDKIEIPLADGNVLVDTPGIINHHQMAHFIDTTTLKAITPKKEVKPAVFQLNEEQTLFLGALARLDYVSGGRKSLVVYVSNNLPIHRTKLEKAEALYEKQAGLVLQPPTEEDMKTLPKLVPYSFTVKEKADIVFSGLGWVTIPEGGAKVTAWVPEGVSATIRTSLV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DGI_A_2(3H2Y)
?
[Raw transfer]




DGI_A_2(3H2Y)
?
[Raw transfer]




GDP_B_4(3EC1)
?
[Raw transfer]




GDP_A_3(3EC1)
?
[Raw transfer]




GDP_A_3(3EC1)
?
[Raw transfer]




GNP_A_3(1PUJ)
RBGA_BACSU
[Raw transfer]




GDP_A_3(3EC1)
?
[Raw transfer]




GNP_A_2(3CNL)
RBGA_THEMA
[Raw transfer]




62 HHSearch 97.0564%-121 - C8 -3H2Y 7.2 ?
61 HHSearch 96.7463%-120 - C8 -3EC1 5.1 ?
1 PsiBlast_PDB 96.5363%-121 - C8 -3H2Y 7.2 ?
2 PsiBlast_PDB 96.2362%-120 - C8 -3EC1 5.1 ?
21 PsiBlast_CBE 96.2062%-121 - C8 -3EC1 5.1 ?
89 Fugue 96.0861%-120 - C8 -3EC1 5.1 ?
64 HHSearch 59.5525%-128 - C8 -1PUJ 7.2 RBGA_BACSU
63 HHSearch 53.4123% -84 * C8 *2YV5 - RSGA_AQUAE -
65 HHSearch 52.6424%-103 - C8 -3CNL 7.8 RBGA_THEMA
66 HHSearch 51.7722% -86 - C8 -1U0L - RSGA_THEMA -
70 HHSearch 49.3323% -83 - C8 -2RCN - RSGA_SALTY -
91 Fugue 47.6017% -54 - C8 -1PUJ - RBGA_BACSU -
4 PsiBlast_PDB 47.1035% -75 - C7 -1PUJ - RBGA_BACSU -
95 Fugue 44.8518% -45 - C8 -1U0L - RSGA_THEMA -
9 PsiBlast_PDB 44.7831% -49 - C7 -2YV5 - RSGA_AQUAE -
67 HHSearch 43.9019% -66 - C8 -1T9H - RSGA_BACSU -
14 PsiBlast_PDB 41.6028% -68 - C9 -2FV8 - RHOB_HUMAN -
96 Fugue 41.5212% -47 - C5 -2QTH - HFLX_SULSO -
93 Fugue 40.7318% -52 - C2 -1MKY - DER_THEMA -
81 HHSearch 40.2119% -53 - C8 -3IEV - ERA_AQUAE -