@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1533: (2016-03-25 )
LYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLFGFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTARQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKLAKEADLTSDAYIKLALQLMTK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_D_8(2ZTC)
RUVA_MYCTU
[Raw transfer]




GOL_A_4(2ZTD)
RUVA_MYCTU
[Raw transfer]




GOL_B_5(2ZTD)
RUVA_MYCTU
[Raw transfer]




GOL_O_15(2H5X)
RUVA_MYCTU
[Raw transfer]




GOL_I_9(2H5X)
RUVA_MYCTU
[Raw transfer]




GOL_K_11(2H5X)
RUVA_MYCTU
[Raw transfer]




GOL_A_5(2ZTC)
RUVA_MYCTU
[Raw transfer]




GOL_B_6(2ZTC)
RUVA_MYCTU
[Raw transfer]




NACID_B_1(1C7Y)
RUVA_ECOLI
[Raw transfer]

-

32 HHSearch 88.9029%-131 - C2 -2ZTD - RUVA_MYCTU -
2 PsiBlast_PDB 85.1433%-115 - C2 -1C7Y 2.9 RUVA_ECOLI
3 PsiBlast_PDB 85.1033%-115 - C2 -1HJP - RUVA_ECOLI -
31 HHSearch 84.9931%-114 - C2 -1CUK - RUVA_ECOLI -
4 PsiBlast_PDB 83.7732%-112 - C2 -1CUK - RUVA_ECOLI -
8 PsiBlast_PDB 83.5932%-115 - C2 -2ZTD 2.0 RUVA_MYCTU
30 PsiBlast_CBE 82.5032%-119 - C2 -2ZTC 2.9 RUVA_MYCTU
27 PsiBlast_CBE 82.0432%-114 - C2 -2ZTD 2.5 RUVA_MYCTU
7 PsiBlast_PDB 81.8232%-116 - C2 -2ZTC 2.8 RUVA_MYCTU
29 PsiBlast_CBE 81.6432%-117 - C2 -2ZTC - RUVA_MYCTU -
5 PsiBlast_PDB 81.5431%-110 - C2 -1BVS - RUVA_MYCLE -
28 PsiBlast_CBE 81.5332%-120 - C2 -2ZTC 3.1 RUVA_MYCTU
6 PsiBlast_PDB 81.4832%-120 - C2 -2H5X 3.1 RUVA_MYCTU
26 PsiBlast_CBE 81.0432%-118 - C2 -2H5X 3.1 RUVA_MYCTU
24 PsiBlast_CBE 80.9632%-115 - C2 -2H5X 2.1 RUVA_MYCTU
25 PsiBlast_CBE 80.6532%-116 - C2 -2H5X - RUVA_MYCTU -
10 PsiBlast_PDB 71.5335%-123 - C2 -1D8L - RUVA_ECOLI -
11 PsiBlast_PDB 70.6433%-113 - C2 -1IXR - RUVA_THET8 -
9 PsiBlast_PDB 70.5732%-112 - C2 -2ZTE - RUVA_MYCTU -
33 HHSearch 70.1133%-117 - C2 -1IXR - RUVA_THET8 -