@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1553: (2016-03-26 )
LQNYSKSEKAFKEAKKVLPGGVNSPVRAFNSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHTDPAVVNAITKAALKGTSFGTPTEIETELAKLVIERVPSIEIVRMVSSGTEATMSAIRLARGYTKREKILKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTITVPYNDIEGAKLAFEKYGEEIAAVIVEPVAGNMGVVPPIEGFLEGLRELTTKFGSLLIFDEVMTGFRVDYYSAQGYYVVTPDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGTLSGNPLAMNAGFETVRQLTPQHYDVFRTLIKRMEEGLTEISARRQVPLSINKAGSMFGFFFTDQKVINFDTAKTSNLEFFRNYYREMLGQGIFLPPSQFEGVFISTMHTENEIDKTLEAFDTTCKILRG

Atome Classification :

(52 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EA5_A_3(2HP1)
GSA_SYNP6
[Raw transfer]




PMP_A_2(3BS8)
GSA_BACSU
[Raw transfer]




KE4_A_3(2HP2)
GSA_SYNP6
[Raw transfer]




PXG_B_4(3FQ7)
GSA_SYNP6
[Raw transfer]




PMP_A_3(2GSA)
GSA_SYNP6
[Raw transfer]




PMP_A_3(2GSA)
GSA_SYNP6
[Raw transfer]




PMP_E_5(3GSB)
GSA_SYNP6
[Raw transfer]




PMP_B_5(3FQA)
GSA_SYNP6
[Raw transfer]




PMP_B_4(2HOZ)
GSA_SYNP6
[Raw transfer]




PMP_B_4(3FQ8)
GSA_SYNP6
[Raw transfer]




PMP_A_3(3FQA)
GSA_SYNP6
[Raw transfer]




PLR_A_3(3USF)
GSA_SYNE7
[Raw transfer]




PMP_C_8(2ZSM)
GSA_AERPE
[Raw transfer]




PMP_A_3(3FQ8)
GSA_SYNP6
[Raw transfer]




PMP_A_3(3FQ8)
GSA_SYNP6
[Raw transfer]




PMP_A_2(2ZSL)
GSA_AERPE
[Raw transfer]




PMP_C_3(3GSB)
GSA_SYNP6
[Raw transfer]




PMP_A_2(2EPJ)
GSA_AERPE
[Raw transfer]




PMP_B_6(2ZSM)
GSA_AERPE
[Raw transfer]




PMP_A_4(2E7U)
GSA_THET8
[Raw transfer]




PMP_A_4(2E7U)
GSA_THET8
[Raw transfer]




PLR_B_5(3USF)
GSA_SYNE7
[Raw transfer]




PMP_A_2(2EPJ)
GSA_AERPE
[Raw transfer]




PMP_A_4(2ZSM)
GSA_AERPE
[Raw transfer]




PLP_B_13(4JEY)
ARGD_SALTY
[Raw transfer]




PLP_B_4(2GSA)
GSA_SYNP6
[Raw transfer]




PLP_A_3(4JEY)
ARGD_SALTY
[Raw transfer]




PLP_A_3(2PB2)
ARGD_SALTY
[Raw transfer]




PLP_B_4(2HP2)
GSA_SYNP6
[Raw transfer]




PLP_B_4(4GSA)
GSA_SYNP6
[Raw transfer]




PLR_A_3(2CFB)
GSA_THEEB
[Raw transfer]




PLP_A_3(4GSA)
GSA_SYNP6
[Raw transfer]




PLP_B_4(2HP1)
GSA_SYNP6
[Raw transfer]




P00_B_18(4JEZ)
ARGD_SALTY
[Raw transfer]




PLP_A_3(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_A_5(2YKY)
?
[Raw transfer]




PLP_B_9(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_B_11(2YKY)
?
[Raw transfer]




PLP_C_21(2YKY)
?
[Raw transfer]




PLP_B_4(2PB0)
ARGD_SALTY
[Raw transfer]




PLP_A_3(2PB0)
ARGD_SALTY
[Raw transfer]




PLP_B_9(2YKX)
?
[Raw transfer]




PLP_C_17(2YKU)
?
[Raw transfer]




PLP_A_4(2YKX)
?
[Raw transfer]




PLP_A_4(2YKU)
?
[Raw transfer]




PLP_C_11(2YKX)
?
[Raw transfer]




PLP_B_10(2YKU)
?
[Raw transfer]




POI_D_4(1WKG)
ARGD_THET8
[Raw transfer]




PLP_B_4(1VEF)
ARGD_THET8
[Raw transfer]




GAB_D_4(3GSB)
GSA_SYNP6
[Raw transfer]




HOZ_B_5(2HP1)
GSA_SYNP6
[Raw transfer]




GAB_A_4(3FQA)
GSA_SYNP6
[Raw transfer]




HOZ_A_4(3USF)
GSA_SYNE7
[Raw transfer]




EDO_A_7(4JEY)
ARGD_SALTY
[Raw transfer]




EDO_B_7(2PB0)
ARGD_SALTY
[Raw transfer]




1 PsiBlast_PDB 97.1571% -92 - C2 -3BS8 3.9 GSA_BACSU
8 PsiBlast_PDB 88.0355% -91 - C2 -2HOZ - GSA_SYNP6 -
4 PsiBlast_PDB 86.7755% -88 - C2 -3GSB 4.4 GSA_SYNP6
9 PsiBlast_PDB 86.7355% -88 - C2 -2HP1 5.4 GSA_SYNP6
25 PsiBlast_CBE 86.6155% -87 - C2 -3FQ7 5.9 GSA_SYNP6
11 PsiBlast_PDB 86.5455% -89 - C2 -3FQA 4.1 GSA_SYNP6
21 PsiBlast_CBE 86.5055% -86 * C2 *4GSA 3.2 GSA_SYNP6
13 PsiBlast_PDB 86.4255% -88 - C2 -3FQ8 4.9 GSA_SYNP6
3 PsiBlast_PDB 86.3355% -86 - C2 -4GSA 3.1 GSA_SYNP6
23 PsiBlast_CBE 86.2855% -87 - C2 -2GSA 3.4 GSA_SYNP6
5 PsiBlast_PDB 86.2755% -88 - C2 -3FQ7 - GSA_SYNP6 -
104 HHSearch 86.2055% -87 - C2 -3FQ8 4.9 GSA_SYNP6
6 PsiBlast_PDB 86.1155% -87 - C2 -3USF 4.4 GSA_SYNE7
31 PsiBlast_CBE 85.8155% -88 - C2 -3FQ8 4.0 GSA_SYNP6
28 PsiBlast_CBE 85.7755% -90 - C2 -2HOZ 4.4 GSA_SYNP6
2 PsiBlast_PDB 85.4255% -85 - C2 -2GSA 5.1 GSA_SYNP6
30 PsiBlast_CBE 85.3655% -87 - C2 -3FQA 4.4 GSA_SYNP6
10 PsiBlast_PDB 85.2055% -91 - C2 -2HP2 5.1 GSA_SYNP6
29 PsiBlast_CBE 85.1055% -95 - C2 -2HOY - GSA_SYNP6 -
125 Fugue 84.7855% -83 - C2 -2GSA 5.1 GSA_SYNP6
26 PsiBlast_CBE 84.7555% -87 - C2 -2HP2 3.7 GSA_SYNP6
27 PsiBlast_CBE 84.3655% -93 - C2 -2HP1 3.0 GSA_SYNP6
22 PsiBlast_CBE 84.2155% -86 - C2 -3GSB 4.8 GSA_SYNP6
103 HHSearch 83.7350% -83 - C2 -2E7U 4.3 GSA_THET8
14 PsiBlast_PDB 83.2450% -85 - C2 -2E7U 4.3 GSA_THET8
33 PsiBlast_CBE 82.8642% -89 - C2 -2ZSM 4.0 GSA_AERPE
24 PsiBlast_CBE 82.2955% -94 - C2 -3USF 4.3 GSA_SYNE7
32 PsiBlast_CBE 82.0042% -87 - C2 -2ZSM 4.2 GSA_AERPE
15 PsiBlast_PDB 81.9742% -86 - C2 -2EPJ 4.8 GSA_AERPE
16 PsiBlast_PDB 81.8642% -86 - C2 -2ZSL 4.8 GSA_AERPE
17 PsiBlast_PDB 81.8242% -84 - C2 -2ZSM 4.3 GSA_AERPE
12 PsiBlast_PDB 79.9456% -98 - C2 -2CFB 2.8 GSA_THEEB
109 HHSearch 74.4841% -77 - C2 -2EPJ 4.8 GSA_AERPE
40 PsiBlast_CBE 62.6933% -74 - C2 -2YKX 3.2 ?
41 PsiBlast_CBE 62.3833% -75 - C2 -2YKX 3.1 ?
37 PsiBlast_CBE 62.3133% -75 - C2 -2YKY 4.4 ?
45 PsiBlast_CBE 61.3833% -74 - C2 -2YKU 3.0 ?
38 PsiBlast_CBE 60.6833% -74 - C2 -2YKY 4.2 ?
44 PsiBlast_CBE 60.6533% -72 - C2 -2YKU 4.4 ?
20 PsiBlast_PDB 60.4033% -73 - C2 -2YKX 3.5 ?
39 PsiBlast_CBE 60.2733% -73 - C2 -2YKY 4.0 ?
18 PsiBlast_PDB 59.4233% -73 - C2 -2YKU 3.1 ?
67 PsiBlast_CBE 52.2432% -77 - C2 -2PB0 2.9 ARGD_SALTY
72 PsiBlast_CBE 52.0432% -76 - C2 -4JEZ 4.2 ARGD_SALTY
65 PsiBlast_CBE 51.5232% -77 - C2 -2PB2 3.8 ARGD_SALTY
69 PsiBlast_CBE 51.0232% -77 - C2 -4JF1 3.5 ARGD_SALTY
68 PsiBlast_CBE 50.1432% -76 - C2 -4JF1 3.6 ARGD_SALTY
66 PsiBlast_CBE 49.4432% -75 - C2 -2PB0 4.3 ARGD_SALTY
77 PsiBlast_CBE 49.2232% -76 - C2 -4JEY 3.3 ARGD_SALTY
76 PsiBlast_CBE 49.1332% -77 - C2 -4JEY 3.4 ARGD_SALTY
50 PsiBlast_CBE 45.1034% -64 - C2 -1VEF 3.3 ARGD_THET8
48 PsiBlast_CBE 43.2634% -57 - C2 -1WKG 3.9 ARGD_THET8