@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1554: (2016-03-26 )
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVVSMPGVFQYPLHELEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPKILVVADTCLCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLDEAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAKSDEQEGADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVIEMLTSMKRAGATLIITYFAKDVSKYLNK

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PBG_A_3(1E51)
HEM2_HUMAN
[Raw transfer]




PBG_A_4(1OHL)
HEM2_YEAST
[Raw transfer]




FMT_B_14(1W5P)
HEM2_PSEAE
[Raw transfer]




FMT_A_5(1W5M)
HEM2_PSEAE
[Raw transfer]




FMT_A_6(1W5P)
HEM2_PSEAE
[Raw transfer]




FMT_A_3(1W56)
HEM2_PSEAE
[Raw transfer]




FMT_B_9(1W5Q)
HEM2_PSEAE
[Raw transfer]




FMT_A_3(1W5N)
HEM2_PSEAE
[Raw transfer]




4OX_A_2(1GJP)
HEM2_YEAST
[Raw transfer]




PB1_A_5(1PV8)
HEM2_HUMAN
[Raw transfer]




PB1_A_5(1PV8)
HEM2_HUMAN
[Raw transfer]




DSB_B_8(1I8J)
HEM2_ECOLI
[Raw transfer]




DSB_A_7(1L6S)
HEM2_ECOLI
[Raw transfer]




SHF_A_8(1B4E)
HEM2_ECOLI
[Raw transfer]




DSB_A_7(1L6S)
HEM2_ECOLI
[Raw transfer]




4OX_A_7(1L6Y)
HEM2_ECOLI
[Raw transfer]




AYC_A_2(2WOQ)
HEM2_PSEAE
[Raw transfer]




SHF_A_2(1H7N)
HEM2_YEAST
[Raw transfer]




DSB_A_7(1I8J)
HEM2_ECOLI
[Raw transfer]




DSB_B_6(2C1H)
HEM2_CHLP8
[Raw transfer]




SHF_A_2(1H7N)
HEM2_YEAST
[Raw transfer]




KAH_A_2(1H7P)
HEM2_YEAST
[Raw transfer]




SHF_A_5(1B4K)
HEM2_PSEAE
[Raw transfer]




SHU_A_2(1H7R)
HEM2_YEAST
[Raw transfer]




SHF_A_5(1B4K)
HEM2_PSEAE
[Raw transfer]




DSB_A_2(1EB3)
HEM2_YEAST
[Raw transfer]




SHF_A_3(1YLV)
HEM2_YEAST
[Raw transfer]




SHF_A_3(1W1Z)
HEM2_CHLP8
[Raw transfer]




SHF_A_3(1W1Z)
HEM2_CHLP8
[Raw transfer]




SHF_B_5(1W1Z)
HEM2_CHLP8
[Raw transfer]




DAV_A_2(1H7O)
HEM2_YEAST
[Raw transfer]




DSB_A_4(2C1H)
HEM2_CHLP8
[Raw transfer]




SHO_A_2(1W31)
HEM2_YEAST
[Raw transfer]




7 PsiBlast_PDB 95.2748%-106 - C5 -1W5P 3.6 HEM2_PSEAE
13 PsiBlast_PDB 94.6847%-105 - C5 -2WOQ 3.4 HEM2_PSEAE
48 HHSearch 94.6252%-103 * C5 *1W1Z 2.5 HEM2_CHLP8
10 PsiBlast_PDB 94.1247%-105 - C5 -1W56 3.6 HEM2_PSEAE
24 PsiBlast_CBE 94.0248%-110 - C5 -1W5Q 3.6 HEM2_PSEAE
25 PsiBlast_CBE 93.9848%-108 - C5 -1W5P 3.6 HEM2_PSEAE
9 PsiBlast_PDB 93.9747%-109 - C5 -1W5N 3.6 HEM2_PSEAE
11 PsiBlast_PDB 93.8747%-104 - C5 -1W5M 3.5 HEM2_PSEAE
12 PsiBlast_PDB 93.8147%-103 - C5 -1B4K 3.7 HEM2_PSEAE
72 Fugue 93.7947%-105 - C5 -1B4K 3.7 HEM2_PSEAE
8 PsiBlast_PDB 93.6547%-105 - C5 -1W5O - HEM2_PSEAE -
22 PsiBlast_CBE 93.3652%-104 - C5 -1W1Z 2.5 HEM2_CHLP8
5 PsiBlast_PDB 93.3651%-100 - C5 -1L6Y 4.4 HEM2_ECOLI
2 PsiBlast_PDB 93.1852%-105 - C5 -2C1H 3.1 HEM2_CHLP8
14 PsiBlast_PDB 93.1646%-104 - C5 -1GZG - HEM2_PSEAE -
21 PsiBlast_CBE 93.0052%-104 - C5 -2C1H 1.5 HEM2_CHLP8
26 PsiBlast_CBE 92.9547%-107 - C5 -1W5O - HEM2_PSEAE -
1 PsiBlast_PDB 92.2852%-106 - C5 -1W1Z 2.5 HEM2_CHLP8
3 PsiBlast_PDB 92.0451% -96 - C5 -1B4E 3.7 HEM2_ECOLI
38 PsiBlast_CBE 91.8842%-103 - C5 -1W31 3.5 HEM2_YEAST
42 PsiBlast_CBE 91.4442%-102 - C5 -1H7R 2.8 HEM2_YEAST
49 HHSearch 91.3951% -95 - C5 -1L6S 2.4 HEM2_ECOLI
43 PsiBlast_CBE 91.0842%-101 - C5 -1H7P 3.4 HEM2_YEAST
4 PsiBlast_PDB 90.9551% -97 - C5 -1L6S 2.4 HEM2_ECOLI
23 PsiBlast_CBE 90.9451% -96 - C5 -1I8J 3.2 HEM2_ECOLI
37 PsiBlast_CBE 90.9342%-103 - C5 -1H7O 2.4 HEM2_YEAST
44 PsiBlast_CBE 90.8142%-100 - C5 -1H7N 3.7 HEM2_YEAST
41 PsiBlast_CBE 90.7742%-103 - C5 -1OHL 3.5 HEM2_YEAST
6 PsiBlast_PDB 90.7051% -95 - C5 -1I8J 2.9 HEM2_ECOLI
20 PsiBlast_PDB 90.6542%-100 - C5 -1YLV 3.4 HEM2_YEAST
17 PsiBlast_PDB 90.6543%-106 - C5 -1E51 4.0 HEM2_HUMAN
35 PsiBlast_CBE 90.3642%-101 - C5 -1GJP 2.3 HEM2_YEAST
36 PsiBlast_CBE 89.9342%-100 - C5 -1EB3 3.1 HEM2_YEAST
50 HHSearch 89.0341% -96 - C5 -1H7N 3.7 HEM2_YEAST
16 PsiBlast_PDB 82.5343%-105 - C5 -1PV8 1.9 HEM2_HUMAN
53 HHSearch 81.4943%-104 - C5 -1PV8 1.9 HEM2_HUMAN