@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1582: (2016-03-26 )
LANEATQELFQVLDNTAIILQNELEISYLEAVYETGENLFQKEVLQKEELSSEKQLKLQESYESIELENFSNEEIRKGLQLALLKGMKHGIQVNHQMTPDSIGFIVAYLLEKVIQKKKNISILDPACGTANLLTTVINQLELKGDVDVHASGVDVDDLLISLALVGADLQRQKMTLLHQDGLANLLVDPVDVVISDLPVGYYPDDENAKTFELCREEGHSFAHFLFIEQGMRYTKPGGYLFFLVPDAMFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSEQARKSILILRKADVNVKPPKEVLLANLSSLTDPSVTAPILAEIENWFKSKQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAM_A_4(2F8L)
?
[Raw transfer]




GOL_A_7(2F8L)
?
[Raw transfer]




1 PsiBlast_PDB 100.0097%-127 - C4 -2F8L 9.4 ?
32 HHSearch 96.8494%-122 - C4 -2F8L 3.1 ?
24 Fugue 56.1217% -85 - C4 -3UFB - ? -
2 PsiBlast_PDB 53.6824%-117 - C4 -3UFB - ? -
11 PsiBlast_PDB 53.6224%-110 - C4 -2IH4 - MTTA_THEAQ -
12 PsiBlast_PDB 53.1424%-110 - C4 -2IH5 - MTTA_THEAQ -
9 PsiBlast_PDB 52.7224%-112 - C4 -2JG3 - MTTA_THEAQ -
37 HHSearch 52.6418% -80 - C4 -3UFB - ? -
7 PsiBlast_PDB 52.4924%-110 - C4 -2IBS - MTTA_THEAQ -
39 HHSearch 52.3720%-118 - C4 -2IH2 - MTTA_THEAQ -
14 PsiBlast_PDB 52.3524%-109 - C4 -2NP7 - MTTA_THEAQ -
3 PsiBlast_PDB 52.3122% -96 - C4 -1AQJ - MTTA_THEAQ -
8 PsiBlast_PDB 51.5724%-106 - C4 -2IBT - MTTA_THEAQ -
10 PsiBlast_PDB 51.3724%-108 - C4 -2IH2 - MTTA_THEAQ -
4 PsiBlast_PDB 51.3522% -95 - C4 -1AQI - MTTA_THEAQ -
23 Fugue 50.9317% -57 - C4 -2AR0 - T1MK_ECOLI -
13 PsiBlast_PDB 50.8124%-105 - C4 -2NP6 - MTTA_THEAQ -
5 PsiBlast_PDB 50.6022% -98 - C4 -2ADM - MTTA_THEAQ -
22 Fugue 50.1914% -64 - C4 -3S1S - ? -
6 PsiBlast_PDB 50.0022% -90 - C4 -1G38 - MTTA_THEAQ -