@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1629: (2016-03-27 )
MIVKICGLKKAVDVAAAVENGADMIGFVFAKSKRQVTVDEAHELAKNIPAGVKKVGVFVNPTEEELTAAIKGVPLDIVQLHGQEPAEQANRTDAEVIKAFPVKDGKLPDNINDYPNAYILLDAPAEEYEGGSGKTFDWDKIDRDLLTKNKLIIAGGLNAQNVQEAIKRFEPYAVDISSGVETNGEKDPQKIKCFIKTAKGVE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

137_B_2(1LBM)
TRPF_THEMA
[Raw transfer]




CIT_A_2(4WUI)
?
[Raw transfer]




2 PsiBlast_PDB 97.0544% -97 - C4 -1NSJ - TRPF_THEMA -
18 HHSearch 95.4544% -92 - C4 -1NSJ - TRPF_THEMA -
1 PsiBlast_PDB 92.5244%-104 - C4 -1LBM 5.7 TRPF_THEMA
17 PsiBlast_CBE 89.1843%-102 - C4 -1DL3 - TRPF_THEMA -
3 PsiBlast_PDB 87.7843% -99 - C4 -1DL3 - TRPF_THEMA -
19 HHSearch 84.8035% -79 - C4 -1V5X - ? -
6 PsiBlast_PDB 83.7531% -82 - C4 -4WUI 2.6 ?
4 PsiBlast_PDB 83.5334% -82 - C4 -1V5X - ? -
5 PsiBlast_PDB 80.8935% -89 - C4 -4AAJ - TRPF_PYRFU -
20 HHSearch 80.5731% -84 - C4 -1PII - TRPC_ECOLI -
7 PsiBlast_PDB 79.6531% -75 - C4 -1PII - TRPC_ECOLI -
8 PsiBlast_PDB 57.8939%-111 - C4 -2KZH - -
27 HHSearch 54.7217% -58 - C4 -1RPX - RPE_SOLTU -
24 HHSearch 53.4714% -39 - C4 -1TQX - ? -
21 HHSearch 53.0015% -64 - C4 -1XI3 - THIE_PYRFU -
15 PsiBlast_PDB 51.5232% -87 - C4 -4DI9 - PDCH_SPHPI -
29 HHSearch 51.2315% -60 - C4 -1TQJ - RPE_SYNY3 -
14 PsiBlast_PDB 51.0232% -87 - C4 -4DI8 - PDCH_SPHPI -
28 HHSearch 50.2913% -69 - C4 -2TPS - THIE_BACSU -
30 HHSearch 49.9420% -49 - C4 -3INP - ? -