@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1667: (2016-03-27 )
LKRKVGIIGTGHVGSDVAFSLVTQGICDEIVLIDKIETKAESEALELRDMASMTNSYTMITSNDWSALGDADVIVMAVGPETLLREDRMEELVETSRSVAEIVPKIIASGFQGIFVNITNPCDVITMLIQKLSGFDHSRVFGTGTSLDTARMRRVVGEALHINPKSVEGYVLGEHGESQFVAWSTVKIGGVSIKDYKTTTSLDLPALKDAVRGGGWNILTGKGWTSFGIATAVAGIVDAILTDAKQVFPLAVFSEKTSTYIGQPALIGANGVIDILEPPLTETEKINFNESAEIIKNAFQLI

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_9(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_A_9(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_B_10(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_D_12(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_C_11(1HYH)
DHL2_WEICO
[Raw transfer]




OXM_R_25(1LTH)
LDH2_BIFL2
[Raw transfer]




OXM_B_6(2XXJ)
LDH_THET8
[Raw transfer]




OXM_D_9(2XXJ)
LDH_THET8
[Raw transfer]




OXM_A_5(3VPH)
LDH_THECA
[Raw transfer]




OXM_B_9(3VPH)
LDH_THECA
[Raw transfer]




OXM_A_5(2V7P)
LDH_THET8
[Raw transfer]




OXM_D_11(2V7P)
LDH_THET8
[Raw transfer]




OXM_C_9(2V7P)
LDH_THET8
[Raw transfer]




OXM_C_13(3VPH)
LDH_THECA
[Raw transfer]




OXM_D_15(3VPH)
LDH_THECA
[Raw transfer]




OXM_B_7(2V7P)
LDH_THET8
[Raw transfer]




21 PsiBlast_CBE 94.9041%-118 - C2 -1HYH 7.8 DHL2_WEICO
22 PsiBlast_CBE 94.7241%-117 - C2 -1HYH 7.0 DHL2_WEICO
114 HHSearch 94.6642%-113 - C2 -1HYH 10.8 DHL2_WEICO
1 PsiBlast_PDB 93.6641%-113 - C2 -1HYH 10.7 DHL2_WEICO
23 PsiBlast_CBE 92.9241%-111 - C2 -1HYH 11.4 DHL2_WEICO
44 PsiBlast_CBE 91.2438%-118 - C2 -2ZQZ - LDH_LACCA -
5 PsiBlast_PDB 91.0438%-115 - C2 -2ZQY - LDH_LACCA -
39 PsiBlast_CBE 90.6538%-119 - C2 -3VKV - LDH_LACCA -
6 PsiBlast_PDB 90.5938%-119 - C2 -2ZQZ - LDH_LACCA -
34 PsiBlast_CBE 90.1138%-123 - C2 -3VKU - LDH_LACCA -
18 PsiBlast_PDB 90.0433% -99 - C2 -2V7P 2.8 LDH_THET8
120 HHSearch 89.9734%-104 - C2 -3VPG - LDH_THECA -
7 PsiBlast_PDB 89.9038%-116 - C2 -3VKV - LDH_LACCA -
80 PsiBlast_CBE 89.8632%-105 - C2 -3VPH 2.7 LDH_THECA
48 PsiBlast_CBE 89.7738%-114 - C2 -2ZQY - LDH_LACCA -
33 PsiBlast_CBE 89.6738%-117 - C2 -3VKU - LDH_LACCA -
68 PsiBlast_CBE 89.5633% -98 - C2 -2XXJ 3.7 LDH_THET8
47 PsiBlast_CBE 89.5138%-113 - C2 -2ZQY - LDH_LACCA -
29 PsiBlast_CBE 89.5138%-109 - C2 -3VPF - LDH_LACCA -
51 PsiBlast_CBE 89.4136%-109 - C2 -3WSW - ? -
74 PsiBlast_CBE 88.8933%-112 - C2 -2V7P 2.2 LDH_THET8
70 PsiBlast_CBE 88.1633% -96 - C2 -2XXJ 3.2 LDH_THET8
77 PsiBlast_CBE 87.9432%-104 - C2 -3VPH 2.1 LDH_THECA
78 PsiBlast_CBE 87.5732%-102 - C2 -3VPH 2.4 LDH_THECA
79 PsiBlast_CBE 87.5032%-103 - C2 -3VPH 2.3 LDH_THECA
73 PsiBlast_CBE 87.4833% -94 - C2 -2V7P 3.0 LDH_THET8
72 PsiBlast_CBE 87.3633%-108 - C2 -2V7P 2.8 LDH_THET8
98 PsiBlast_CBE 83.3931%-107 - C2 -1LTH 2.3 LDH2_BIFL2