@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1747: (2016-03-28 )
METVLKAHKVRKVYGSKGNLFSALGSISLEIQKGSFVGIMGPSGAGKSTLLNVLSSIDKPTSGEIEIGGKQISTMNGKELAVFRRDQLGFIFQDYNLLDTMTVKDNIVLPLALAHIKQAEIDQRFEIIARQFGIFELRNKYPTEISGGQKQRTAVCRAMITEPTLIFADEPTGALDSKSATNLLEGLSQAKDVRDSTIMMVTHDAFAASYCERIMFIKDGEIFTEIYRGTSSRKQFFQKVLDVLALLGGGENDVI

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_B_7(2ONJ)
Y1866_STAAM
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ANP_A_8(2ONJ)
Y1866_STAAM
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ADP_B_6(2HYD)
Y1866_STAAM
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_5(2HYD)
Y1866_STAAM
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




11 PsiBlast_PDB 86.7434%-108 - C1 -4YMS - ? -
14 PsiBlast_PDB 86.2834%-105 - C1 -4YMV - ? -
31 PsiBlast_CBE 86.2634%-106 - C1 -4YMV - ? -
32 PsiBlast_CBE 86.1734%-108 - C1 -4YMU - ? -
12 PsiBlast_PDB 85.6234%-108 - C1 -4YMT - ? -
13 PsiBlast_PDB 85.5934%-107 - C1 -4YMU - ? -
15 PsiBlast_PDB 84.8034%-105 - C1 -4YMW - ? -
35 PsiBlast_CBE 84.2731%-112 - C1 -4U02 - ? -
22 PsiBlast_CBE 83.8337%-101 - C1 -3TIF - Y796_METJA -
1 PsiBlast_PDB 83.6338% -99 - C1 -1L2T - Y796_METJA -
21 PsiBlast_CBE 83.4938% -99 - C1 -1L2T - Y796_METJA -
23 PsiBlast_CBE 83.2736%-104 - C1 -2PCJ - LOLD_AQUAE -
36 PsiBlast_CBE 83.0731%-105 - C1 -4U02 - ? -
120 HHSearch 82.9038%-102 - C1 -3TIF - Y796_METJA -
117 HHSearch 82.6737% -98 - C1 -2PCJ - LOLD_AQUAE -
4 PsiBlast_PDB 82.3536% -98 - C1 -2PCJ - LOLD_AQUAE -
20 PsiBlast_PDB 82.3031%-110 - C1 -4U00 - ? -
37 PsiBlast_CBE 82.1831%-105 - C1 -4U02 - ? -
5 PsiBlast_PDB 81.8536% -96 - C1 -2PCL - LOLD_AQUAE -
124 Fugue 81.7631%-110 - C1 -3TUZ - METN_ECOLI -
90 PsiBlast_CBE 76.3036%-100 - C1 -3FVQ 5.4 FBPC_NEIG1
91 PsiBlast_CBE 75.9436% -99 - C1 -3FVQ 4.6 FBPC_NEIG1
60 PsiBlast_CBE 73.7932%-103 - C1 -2OLJ 6.0 ?
55 PsiBlast_CBE 72.7432% -94 - C1 -2OLK 6.1 ?
56 PsiBlast_CBE 72.3032% -95 - C1 -2OLK 6.3 ?
96 PsiBlast_CBE 71.8531%-102 - C1 -1B0U 5.9 HISP_SALTY
58 PsiBlast_CBE 71.4732% -93 - C1 -2OLK 6.0 ?
47 PsiBlast_CBE 71.0632%-100 - C1 -3C4J 5.6 ?
50 PsiBlast_CBE 70.8332% -96 - C1 -2Q0H 5.7 ?
61 PsiBlast_CBE 70.7032% -99 - C1 -3C41 6.0 ?
62 PsiBlast_CBE 70.6832% -99 - C1 -3C41 7.0 ?
48 PsiBlast_CBE 70.1932% -93 - C1 -3C4J 6.7 ?
57 PsiBlast_CBE 69.8232% -93 - C1 -2OLK 6.5 ?
59 PsiBlast_CBE 68.8832% -90 - C1 -2OLJ 5.9 ?
49 PsiBlast_CBE 68.0432% -93 - C1 -2Q0H 6.0 ?
100 PsiBlast_CBE 56.4133% -92 - C1 -2HYD 3.3 Y1866_STAAM
99 PsiBlast_CBE 56.3433% -92 - C1 -2HYD 3.2 Y1866_STAAM
97 PsiBlast_CBE 55.7233% -90 - C1 -2ONJ 5.9 Y1866_STAAM
98 PsiBlast_CBE 55.5333% -91 - C1 -2ONJ 5.8 Y1866_STAAM