@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1758: (2016-03-28 )
MADKKRYEELINILDQYSYDYYVIDNPTVEDAEYDQKMQELLKIEEAHPEWVTPESPSKRVGGEVLEGFKKVAHDTPMLSLANAFNHEDLADFDRRIRDKVGDDIAYMCELKIDGLAVSLQYENGKYKQGATRGDGTIGEDITANLRTIRSIPMKLQKDYSIEVRGEAFMPKRSFQKLNEIREEEGQMLFANPRNAAAGSLRQLDTKIAASRNLDIFLYAVADFGEMGVETHSAGLDMLETLGLKVNKERRLCSSLEEVYAYIDEWTEKRADLAYDIDGIVLKLNNLEQQRQMGTTVKSPRWSIAYKFPAEEVPTKLLDIELNVGRTGVITPTAVLEPVRVAGTTVSRASLHNEDLITEKDIRIGDTVLIKKAGDIIPEVIKSITEERSGSEEPFHMPKKCPTCDSELVRLEEEVALRCINPKCPAQIKEGLIHFVSRNAMNIDGLGEKVIIQLFSQHLIKDVADLFFLSKEKLLELERMGEKSVTNLLASIEASKQNSLEKLLFGLGIRHVGAKAAKSLAVHFETMDNLKVADKETLTSINDIGEKMADSIVTYFANEEVHDLLEELKRAGVNMTYTGPKLEDMSEEELVFAGKTVVLTGKLEKLTRNDAKALIESLGGNVSGSVSKKTDVVVAGSDAGSKLAKAEELAIPIWSEEDLIEYLPDEGGLNE

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3BA_A_7(3BAA)
DNLJ_ENTFA
[Raw transfer]




3BD_A_7(3BAB)
DNLJ_ENTFA
[Raw transfer]




0OW_A_5(4EFB)
DNLJ_ENTFA
[Raw transfer]




3B9_A_7(3BA9)
DNLJ_ENTFA
[Raw transfer]




0OV_A_5(4EFE)
DNLJ_ENTFA
[Raw transfer]




0OX_A_5(4EEQ)
DNLJ_ENTFA
[Raw transfer]




0XT_B_6(4GLW)
DNLJ_STRZP
[Raw transfer]




3B8_A_6(3BA8)
DNLJ_ENTFA
[Raw transfer]




AMP_D_10(2OWO)
DNLJ_ECOLI
[Raw transfer]




0XT_A_4(4GLW)
DNLJ_STRZP
[Raw transfer]




IVH_A_2(3PN1)
DNLJ_HAEIN
[Raw transfer]




0XS_A_7(4GLX)
DNLJ_ECOLI
[Raw transfer]




3B9_A_5(3BAC)
DNLJ_HAEIN
[Raw transfer]




AMP_B_2(1ZAU)
DNLJ_MYCTU
[Raw transfer]




AMP_B_2(1ZAU)
DNLJ_MYCTU
[Raw transfer]




GOL_E_5(1TA8)
DNLJ_ENTFA
[Raw transfer]




L5Y_A_3(4CC6)
DNLJ_STAAU
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




AMP_A_5(1DGS)
DNLJ_THEFI
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




AMP_A_5(1V9P)
DNLJ_THEFI
[Raw transfer]




AMP_A_5(1DGS)
DNLJ_THEFI
[Raw transfer]




1X8_A_2(4LH7)
DNLJ_ENTFA
[Raw transfer]




1X7_A_2(4LH6)
DNLJ_ENTFA
[Raw transfer]




AMP_B_6(1V9P)
DNLJ_THEFI
[Raw transfer]




AMP_B_6(1DGS)
DNLJ_THEFI
[Raw transfer]




AMP_A_2(3SGI)
DNLJ_MYCTU
[Raw transfer]




AMP_A_2(3SGI)
DNLJ_MYCTU
[Raw transfer]




L5V_A_3(4CC5)
DNLJ_STAAU
[Raw transfer]




NACID_D_3(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

NACID_D_3(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_D_3(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_C_2(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_C_2(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

1 PsiBlast_PDB 92.1546% -73 - C4 -2OWO 6.8 DNLJ_ECOLI
34 HHSearch 91.9746% -72 - C4 -2OWO 6.5 DNLJ_ECOLI
2 PsiBlast_PDB 89.0845% -76 - C4 -4GLX 8.1 DNLJ_ECOLI
4 PsiBlast_PDB 87.2345% -68 - C4 -1V9P 5.1 DNLJ_THEFI
22 PsiBlast_CBE 86.9545% -65 - C4 -1V9P 4.9 DNLJ_THEFI
56 Fugue 86.6544% -64 - C4 -1DGS 5.2 DNLJ_THEFI
21 PsiBlast_CBE 85.8443% -62 - C4 -1DGS 5.4 DNLJ_THEFI
3 PsiBlast_PDB 85.0443% -62 - C4 -1DGS 5.3 DNLJ_THEFI
13 PsiBlast_PDB 70.4058% -56 - C4 -4EEQ 5.0 DNLJ_ENTFA
8 PsiBlast_PDB 70.2358% -59 - C4 -3BA8 6.3 DNLJ_ENTFA
15 PsiBlast_PDB 69.7558% -57 - C4 -4EFE 7.1 DNLJ_ENTFA
14 PsiBlast_PDB 69.5458% -58 - C4 -4EFB 6.1 DNLJ_ENTFA
9 PsiBlast_PDB 69.4458% -58 - C4 -3BA9 7.8 DNLJ_ENTFA
12 PsiBlast_PDB 69.1258% -54 - C4 -1TA8 2.2 DNLJ_ENTFA
10 PsiBlast_PDB 68.7758% -56 - C4 -3BAA 8.0 DNLJ_ENTFA
11 PsiBlast_PDB 68.2658% -57 - C4 -3BAB 8.1 DNLJ_ENTFA
16 PsiBlast_PDB 68.0758% -57 - C4 -4LH6 4.6 DNLJ_ENTFA
25 PsiBlast_CBE 67.7458% -50 - C4 -1TAE - DNLJ_ENTFA -
24 PsiBlast_CBE 67.4358% -55 - C4 -1TAE - DNLJ_ENTFA -
23 PsiBlast_CBE 67.0858% -55 - C4 -1TAE - DNLJ_ENTFA -
19 PsiBlast_PDB 66.7758% -53 - C4 -4CC5 4.2 DNLJ_STAAU
17 PsiBlast_PDB 66.4558% -54 - C4 -4LH7 4.7 DNLJ_ENTFA
20 PsiBlast_PDB 65.1458% -55 - C4 -4CC6 7.2 DNLJ_STAAU
36 HHSearch 63.5447% -46 - C4 -3UQ8 6.4 DNLJ_HAEIN
29 PsiBlast_CBE 62.1347% -49 - C4 -3UQ8 6.4 DNLJ_HAEIN
30 PsiBlast_CBE 61.3647% -52 - C4 -3PN1 7.0 DNLJ_HAEIN
27 PsiBlast_CBE 60.8349% -55 - C4 -4GLW 4.4 DNLJ_STRZP
35 HHSearch 60.6341% -33 - C4 -3SGI 4.5 DNLJ_MYCTU
5 PsiBlast_PDB 60.0541% -34 - C4 -3SGI 4.5 DNLJ_MYCTU
28 PsiBlast_CBE 59.3549% -52 - C4 -4GLW 5.0 DNLJ_STRZP
38 HHSearch 57.2942% -46 - C4 -1ZAU 5.2 DNLJ_MYCTU
31 PsiBlast_CBE 55.7142% -44 - C4 -1ZAU 5.2 DNLJ_MYCTU
32 PsiBlast_CBE 53.2648% -53 - C4 -3BAC 8.1 DNLJ_HAEIN