@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1766: (2016-03-28 )
MNIAIFASGSGSNFQALVDDEFIKPYVKLLVCDKPNAYVLERANKHDIPVFLFEAKNYPDKEAFETEILLELRRLEIDLLVLAGYMRLIGPTLLAEFPEQIVNLHPSLLPEFKGKDAIGQAIQANVSGTGVTAHFVDAGMDTGPIIDQVKVTIETAETTDTLAEKIHQVEHIFYPKVIRGLIQNGGND

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KT5_D_4(1RC0)

[Raw transfer]




KEU_K_11(1RBQ)
PUR2_HUMAN
[Raw transfer]




KT5_D_4(1RBZ)

[Raw transfer]




KEU_L_12(1RBQ)
PUR2_HUMAN
[Raw transfer]




KEU_H_8(1RBY)

[Raw transfer]




KT5_H_8(1RBM)

[Raw transfer]




KT3_E_5(1RC1)
PUR2_HUMAN
[Raw transfer]




KEU_M_13(1RBQ)
PUR2_HUMAN
[Raw transfer]




KT5_C_3(1RC0)
PUR2_HUMAN
[Raw transfer]




KEU_N_14(1RBQ)

[Raw transfer]




KEU_F_6(1RBY)
PUR2_HUMAN
[Raw transfer]




KT5_G_7(1RBM)
PUR2_HUMAN
[Raw transfer]




KT3_F_6(1RC1)

[Raw transfer]




KEU_G_7(1NJS)

[Raw transfer]




KEU_F_6(1NJS)
PUR2_HUMAN
[Raw transfer]




KEU_E_5(1RBY)
PUR2_HUMAN
[Raw transfer]




KEU_G_7(1RBY)
PUR2_HUMAN
[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




GOL_A_6(4DS3)
?
[Raw transfer]




GOL_F_6(1MEJ)

[Raw transfer]




GOL_B_6(3KCQ)
?
[Raw transfer]




GOL_C_7(3KCQ)
?
[Raw transfer]




GOL_D_8(3KCQ)
?
[Raw transfer]




THH_B_6(3DCJ)
PUR3_MYCTU
[Raw transfer]




GOL_B_13(3P9X)
?
[Raw transfer]




THH_A_3(3DCJ)
PUR3_MYCTU
[Raw transfer]




GAR_F_6(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_F_6(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_F_6(1MEN)

[Raw transfer]




GAR_D_4(1MEN)
PUR2_HUMAN
[Raw transfer]




GAR_E_5(1MEN)
PUR2_HUMAN
[Raw transfer]




GAR_A_5(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_C_9(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_B_7(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_D_11(1CDE)
PUR3_ECOLI
[Raw transfer]




GRF_B_2(1ZLY)

[Raw transfer]




88 HHSearch 94.8152%-146 - C4 -3P9X - ? -
2 PsiBlast_PDB 94.7951%-148 - C4 -3P9X - ? -
21 PsiBlast_CBE 94.1951%-150 - C4 -3P9X 2.2 ?
89 HHSearch 88.6158%-110 - C4 -3AV3 - ? -
1 PsiBlast_PDB 87.9757%-114 - C4 -3AV3 - ? -
59 PsiBlast_CBE 86.1333%-139 - C4 -3KCQ 2.4 ?
60 PsiBlast_CBE 86.0933%-145 - C4 -3KCQ 1.8 ?
93 HHSearch 85.9833%-144 - C4 -3KCQ 1.8 ?
90 HHSearch 85.9039%-144 - C4 -3AUF - ? -
4 PsiBlast_PDB 85.6435%-147 - C4 -2YWR - ? -
5 PsiBlast_PDB 85.5339%-150 - C4 -3AUF - ? -
58 PsiBlast_CBE 85.4533%-143 - C4 -3KCQ 2.4 ?
54 PsiBlast_CBE 85.0433%-144 - C4 -3GAR - PUR3_ECOLI -
3 PsiBlast_PDB 84.9542%-140 - C4 -4S1N - ? -
12 PsiBlast_PDB 84.7634%-147 - C4 -1CDE 3.6 PUR3_ECOLI
40 PsiBlast_CBE 84.7434%-151 - C4 -1JKX - PUR3_ECOLI -
94 HHSearch 84.6036%-140 - C4 -2YWR - ? -
11 PsiBlast_PDB 84.4634%-150 - C4 -1JKX - PUR3_ECOLI -
6 PsiBlast_PDB 84.4234%-148 - C4 -1C3E 3.3 PUR3_ECOLI
10 PsiBlast_PDB 84.4134%-148 - C4 -1C2T 3.5 PUR3_ECOLI
43 PsiBlast_CBE 84.2434%-147 - C4 -1CDE 3.6 PUR3_ECOLI
57 PsiBlast_CBE 84.2033%-144 * C4 *3KCQ 2.8 ?
45 PsiBlast_CBE 84.1934%-147 - C4 -1CDE 3.8 PUR3_ECOLI
44 PsiBlast_CBE 84.1334%-147 - C4 -1CDE 3.6 PUR3_ECOLI
22 PsiBlast_CBE 84.0634%-149 - C4 -1C3E 2.8 PUR3_ECOLI
47 PsiBlast_CBE 84.0334%-149 - C4 -1C2T 2.9 PUR3_ECOLI
48 PsiBlast_CBE 82.9233%-135 - C4 -1MEN 3.9
51 PsiBlast_CBE 82.6833%-142 - C4 -1MEJ 2.7
35 PsiBlast_CBE 82.3133%-131 - C4 -1RBQ 6.7 PUR2_HUMAN
49 PsiBlast_CBE 82.1933%-138 - C4 -1MEN 3.4 PUR2_HUMAN
34 PsiBlast_CBE 82.1633%-134 - C4 -1RBQ 7.2 PUR2_HUMAN
37 PsiBlast_CBE 82.0833%-136 - C4 -1NJS 7.0
31 PsiBlast_CBE 81.9733%-134 - C4 -1RBY 6.3 PUR2_HUMAN
30 PsiBlast_CBE 81.8633%-133 - C4 -1RBY 6.6
50 PsiBlast_CBE 81.8533%-132 - C4 -1MEN 3.9 PUR2_HUMAN
20 PsiBlast_PDB 81.7233%-133 - C4 -1RC1 7.0 PUR2_HUMAN
32 PsiBlast_CBE 81.7133%-133 - C4 -1RBY 6.6 PUR2_HUMAN
17 PsiBlast_PDB 81.7133%-132 - C4 -1RBY 6.7 PUR2_HUMAN
14 PsiBlast_PDB 81.7033%-130 - C4 -1NJS 6.7 PUR2_HUMAN
28 PsiBlast_CBE 81.6033%-130 - C4 -1RC0 5.8
36 PsiBlast_CBE 81.5733%-132 - C4 -1RBM 8.2
27 PsiBlast_CBE 81.5733%-135 - C4 -1RC1 8.4
16 PsiBlast_PDB 81.5533%-130 - C4 -1RBQ 6.9 PUR2_HUMAN
26 PsiBlast_CBE 81.3633%-131 - C4 -1ZLY 3.2
19 PsiBlast_PDB 81.2533%-130 - C4 -1RC0 6.7 PUR2_HUMAN
15 PsiBlast_PDB 81.2133%-127 - C4 -1RBM 6.4 PUR2_HUMAN
56 PsiBlast_CBE 81.1937%-127 - C4 -4DS3 2.2 ?
33 PsiBlast_CBE 80.9233%-129 - C4 -1RBQ 6.7
29 PsiBlast_CBE 80.9233%-133 - C4 -1RBZ 5.8
61 PsiBlast_CBE 75.8034%-113 - C4 -3DCJ 5.5 PUR3_MYCTU
62 PsiBlast_CBE 75.0134%-120 - C4 -3DCJ 5.0 PUR3_MYCTU