Study : Lmo1772 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: EDO_A_7(3KRE) / Model_16(3KRE/A) = [3.2] Download351.251.40VTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYKDDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRDAAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRLKQVQN
Complex: EDO_A_7(3KRE) / Model_35(3KRE/A) = [3.2] Download487.071.40VTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYKDDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRDAAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRLKQVQN
Complex: ADP_A_3(4O7V) / Model_12(4O7V/A) = [4.3] Download1155.1920.15VTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYKDDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRDAAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRLKQVQN
Complex: ADP_A_3(4O7T) / Model_11(4O7T/A) = [4.9] Download1274.8617.38VTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYKDDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRDAAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRLKQVQN
Complex: AIR_A_3(4FE2) / Model_2(4FE2/A) = [5.1] Download934.52-1.41VTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYKDDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRDAAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRLKQVQN
Consensus
[pKd Mean = 4.14]
-840
(s=363)
7
(s=9)
VTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYKDDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRDAAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRLKQVQN