@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1772: (2016-03-28 )
VTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYKDDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRDAAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRLKQVQN

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_8(3NUA)
PUR7_CLOP1
[Raw transfer]




AMP_A_11(4O81)
PUR7_PYRHO
[Raw transfer]




C5P_A_2(4O7Y)
PUR7_PYRHO
[Raw transfer]




AIR_A_3(4FE2)
PUR7_STRPN
[Raw transfer]




C2R_A_10(2GQS)
PUR7_ECOLI
[Raw transfer]




C2R_B_12(2GQS)
PUR7_ECOLI
[Raw transfer]




TYD_A_2(4O7S)
PUR7_PYRHO
[Raw transfer]




U5P_A_2(4O7R)
PUR7_PYRHO
[Raw transfer]




ATP_A_7(2Z02)
PUR7_METJA
[Raw transfer]




ATP_A_3(4O7W)
PUR7_PYRHO
[Raw transfer]




ADP_A_2(4O7L)
PUR7_PYRHO
[Raw transfer]




ATP_B_6(2Z02)
PUR7_METJA
[Raw transfer]




ADP_A_4(4NYE)
PUR7_STRPN
[Raw transfer]




ADP_A_3(4O7V)
PUR7_PYRHO
[Raw transfer]




ADP_A_4(4FGR)
PUR7_STRPN
[Raw transfer]




ADP_B_13(2YWV)
?
[Raw transfer]




ADP_A_3(3NUA)
PUR7_CLOP1
[Raw transfer]




ADP_A_3(4O7T)
PUR7_PYRHO
[Raw transfer]




ADP_A_3(3NUA)
PUR7_CLOP1
[Raw transfer]




ADP_A_4(2YZL)
PUR7_METJA
[Raw transfer]




ADP_A_5(4O7N)
PUR7_PYRHO
[Raw transfer]




ADP_A_8(4O86)
PUR7_PYRHO
[Raw transfer]




ADP_B_12(4FE2)
PUR7_STRPN
[Raw transfer]




EDO_A_7(3KRE)
PUR7_EHRCR
[Raw transfer]




EDO_A_7(3KRE)
PUR7_EHRCR
[Raw transfer]




ADP_B_8(4FGR)
PUR7_STRPN
[Raw transfer]




ADP_B_8(4NYE)
PUR7_STRPN
[Raw transfer]




ADP_A_10(4O82)
PUR7_PYRHO
[Raw transfer]




AMP_A_12(4O83)
PUR7_PYRHO
[Raw transfer]




EDO_A_4(3KRE)
PUR7_EHRCR
[Raw transfer]




39 HHSearch 96.6759% -74 - C2 -2YWV - ? -
1 PsiBlast_PDB 95.3660% -77 - C2 -2YWV - ? -
21 PsiBlast_CBE 94.6960% -74 - C2 -2YWV 6.8 ?
3 PsiBlast_PDB 94.3852% -80 - C2 -4FGR 6.3 PUR7_STRPN
4 PsiBlast_PDB 93.4652% -80 - C2 -4NYE 6.1 PUR7_STRPN
25 PsiBlast_CBE 92.9253% -76 - C2 -3NUA 6.5 PUR7_CLOP1
5 PsiBlast_PDB 92.8853% -79 - C2 -3NUA 8.2 PUR7_CLOP1
24 PsiBlast_CBE 92.4652% -78 - C2 -4FE2 5.9 PUR7_STRPN
34 HHSearch 92.4354% -73 - C2 -3NUA 8.2 PUR7_CLOP1
2 PsiBlast_PDB 92.3052% -79 - C2 -4FE2 5.1 PUR7_STRPN
22 PsiBlast_CBE 91.5352% -81 - C2 -4NYE 6.1 PUR7_STRPN
23 PsiBlast_CBE 91.4152% -82 - C2 -4FGR 6.1 PUR7_STRPN
14 PsiBlast_PDB 89.5147% -79 - C2 -4O7Y 5.7 PUR7_PYRHO
13 PsiBlast_PDB 88.8747% -74 - C2 -4O7W 6.7 PUR7_PYRHO
9 PsiBlast_PDB 88.6447% -74 - C2 -4O7R 5.6 PUR7_PYRHO
40 HHSearch 88.5846% -72 - C2 -3U55 - PUR7_PYRHO -
6 PsiBlast_PDB 88.3047% -76 - C2 -3U55 - PUR7_PYRHO -
15 PsiBlast_PDB 88.1747% -80 - C2 -4O86 5.2 PUR7_PYRHO
12 PsiBlast_PDB 87.9747% -77 - C2 -4O7V 4.3 PUR7_PYRHO
10 PsiBlast_PDB 87.8147% -88 - C2 -4O7S 6.4 PUR7_PYRHO
8 PsiBlast_PDB 87.8047% -75 - C2 -4O7N 6.4 PUR7_PYRHO
7 PsiBlast_PDB 87.7947% -74 - C2 -4O7L 5.1 PUR7_PYRHO
11 PsiBlast_PDB 87.6847% -80 - C2 -4O7T 4.9 PUR7_PYRHO
26 PsiBlast_CBE 87.2045% -73 - C2 -2Z02 6.5 PUR7_METJA
19 PsiBlast_PDB 87.1947% -72 - C2 -4O82 5.3 PUR7_PYRHO
28 PsiBlast_CBE 87.1145% -70 - C2 -2YZL 5.7 PUR7_METJA
20 PsiBlast_PDB 86.7547% -75 - C2 -4O83 5.4 PUR7_PYRHO
16 PsiBlast_PDB 86.7244% -72 - C2 -3KRE 3.2 PUR7_EHRCR
18 PsiBlast_PDB 86.5347% -71 - C2 -4O81 6.5 PUR7_PYRHO
27 PsiBlast_CBE 85.9745% -73 - C2 -2Z02 5.9 PUR7_METJA
35 HHSearch 85.7044% -70 - C2 -3KRE 3.2 PUR7_EHRCR
29 PsiBlast_CBE 84.9042% -78 - C2 -2GQS 5.6 PUR7_ECOLI
30 PsiBlast_CBE 83.6842% -73 - C2 -2GQS 5.5 PUR7_ECOLI