Study : Lmo1801 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C8_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C8_S1
Complex: ACY_A_9(1JPN) / Model_11(1JPN/A) = [3.2] Download110.3419.25MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVNFKVVKQFIKTVSERAVGADVMKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVIMMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVVDSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKMEALETFHPDRMASRILGMGDVLSLIEKAQTDVDTEKMKAMEQKMKDNSMTLDDFLEQLQQVKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRRKRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF
Complex: GCP_B_6(1RJ9) / Model_98(1RJ9/A) = [3.4] Download1530.3626.67MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVNFKVVKQFIKTVSERAVGADVMKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVIMMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVVDSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKMEALETFHPDRMASRILGMGDVLSLIEKAQTDVDTEKMKAMEQKMKDNSMTLDDFLEQLQQVKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRRKRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF
Complex: EDO_A_12(3NG1) / Model_16(3NG1/A) = [3.7] Download99.2519.25MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVNFKVVKQFIKTVSERAVGADVMKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVIMMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVVDSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKMEALETFHPDRMASRILGMGDVLSLIEKAQTDVDTEKMKAMEQKMKDNSMTLDDFLEQLQQVKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRRKRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF
Complex: EDO_B_14(3NG1) / Model_32(3NG1/B) = [3.7] Download103.7219.25MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVNFKVVKQFIKTVSERAVGADVMKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVIMMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVVDSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKMEALETFHPDRMASRILGMGDVLSLIEKAQTDVDTEKMKAMEQKMKDNSMTLDDFLEQLQQVKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRRKRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF
Complex: ACY_B_7(1JPN) / Model_31(1JPN/B) = [3.7] Download123.9225.46MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVNFKVVKQFIKTVSERAVGADVMKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVIMMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVVDSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKMEALETFHPDRMASRILGMGDVLSLIEKAQTDVDTEKMKAMEQKMKDNSMTLDDFLEQLQQVKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRRKRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF
Consensus
[pKd Mean = 3.54]
-393
(s=568)
21
(s=3)
MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVNFKVVKQFIKTVSERAVGADVMKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVIMMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVVDSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKMEALETFHPDRMASRILGMGDVLSLIEKAQTDVDTEKMKAMEQKMKDNSMTLDDFLEQLQQVKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRRKRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF