@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1803: (2016-03-28 )
MTFFKKLKDKITQQTDSVSGKFKDGLSKTRGNFSGKINEMVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQGDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVDVIKQAEGSDPAAVMFDAVQAAKARKADILLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMVDNEK

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_6(2J7P)
FTSY_THEAQ
[Raw transfer]




GCP_B_6(1RJ9)
SRP54_THEAQ
[Raw transfer]




GCP_D_17(1OKK)
FTSY_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
FTSY_ECOLI
[Raw transfer]




GNP_A_12(2J7P)
SRP54_THEAQ
[Raw transfer]




GNP_B_20(2J7P)
SRP54_THEAQ
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GDP_A_6(1O87)
SRP54_THEAQ
[Raw transfer]




GNP_B_20(2J7P)
FTSY_THEAQ
[Raw transfer]




GDP_A_16(3DM5)
SRP54_PYRFU
[Raw transfer]




GNP_K_11(2Q9C)
FTSY_THEAQ
[Raw transfer]




GDP_A_16(3DM5)
SRP54_PYRFU
[Raw transfer]




GNP_B_2(1JPJ)
SRP54_THEAQ
[Raw transfer]




GCP_A_3(1OKK)
FTSY_THEAQ
[Raw transfer]




GNP_A_6(1JPN)
SRP54_THEAQ
[Raw transfer]




GNP_B_5(1JPN)
SRP54_THEAQ
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




GDP_A_8(4C7O)
FTSY_ECOLI
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




GOL_B_14(3DMD)
?
[Raw transfer]




GNP_A_12(2J7P)
FTSY_THEAQ
[Raw transfer]




GOL_C_16(3DMD)
?
[Raw transfer]




GOL_A_15(3DMD)
?
[Raw transfer]




GNP_T_20(2Q9B)
FTSY_THEAQ
[Raw transfer]




GDP_C_14(4C7O)
FTSY_ECOLI
[Raw transfer]




FMT_A_5(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_B_2(2NG1)
SRP54_THEAQ
[Raw transfer]




GDP_B_12(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_D_2(2IYL)
FTSY_THEAQ
[Raw transfer]




CIT_B_4(1VMA)
?
[Raw transfer]




GDP_B_11(4C7O)
SRP54_ECOLI
[Raw transfer]




GDP_A_7(1NG1)
SRP54_THEAQ
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




FMT_B_11(1O87)
SRP54_THEAQ
[Raw transfer]




GCP_D_17(1OKK)
SRP54_THEAQ
[Raw transfer]




EDO_B_13(3NG1)
SRP54_THEAQ
[Raw transfer]




EDO_A_2(2YHS)
FTSY_ECOLI
[Raw transfer]




EDO_A_12(3NG1)
SRP54_THEAQ
[Raw transfer]




GDP_D_18(4C7O)
FTSY_ECOLI
[Raw transfer]




EDO_B_14(3NG1)
SRP54_THEAQ
[Raw transfer]




GDP_D_18(4C7O)
SRP54_ECOLI
[Raw transfer]




ACY_B_7(1JPN)
SRP54_THEAQ
[Raw transfer]




ACY_A_9(1JPN)
SRP54_THEAQ
[Raw transfer]




10 PsiBlast_PDB 93.5252% -99 - C6 -1VMA - ? -
23 PsiBlast_CBE 93.4952%-100 - C6 -1VMA 3.8 ?
87 HHSearch 92.9854% -94 - C6 -1VMA - ? -
2 PsiBlast_PDB 92.8750%-101 - C6 -2QY9 - FTSY_ECOLI -
77 HHSearch 92.6742%-111 - C6 -3B9Q - CFTSY_ARATH -
1 PsiBlast_PDB 92.3950%-103 - C6 -2YHS - FTSY_ECOLI -
12 PsiBlast_PDB 92.1942%-109 - C6 -3B9Q - CFTSY_ARATH -
78 HHSearch 92.0948%-101 - C6 -2YHS 2.5 FTSY_ECOLI
7 PsiBlast_PDB 91.8945%-103 - C6 -1ZU4 - FTSY_MYCMS -
90 HHSearch 91.6746%-109 - C6 -1ZU4 - FTSY_MYCMS -
4 PsiBlast_PDB 91.5850%-102 - C6 -1FTS - FTSY_ECOLI -
3 PsiBlast_PDB 91.5750%-102 - C6 -2XXA - FTSY_ECOLI -
22 PsiBlast_CBE 91.5551%-108 - C6 -4C7O 3.2 FTSY_ECOLI
21 PsiBlast_CBE 91.3050%-102 - C6 -2XXA - FTSY_ECOLI -
8 PsiBlast_PDB 90.6445%-102 - C6 -1ZU5 - FTSY_MYCMS -
5 PsiBlast_PDB 90.5150%-102 - C6 -3ZN8 - FTSY_ECOLI -
6 PsiBlast_PDB 90.2751%-103 - C6 -4C7O 6.9 FTSY_ECOLI
76 HHSearch 89.6141%-109 - C6 -2OG2 - CFTSY_ARATH -
11 PsiBlast_PDB 89.5441%-106 - C6 -2OG2 - CFTSY_ARATH -
9 PsiBlast_PDB 88.4246%-108 - C6 -4AK9 - ? -
91 HHSearch 88.2049%-103 - C6 -1RJ9 2.5 FTSY_THEAQ
16 PsiBlast_PDB 84.3849%-103 - C6 -1OKK 9.2 FTSY_THEAQ
18 PsiBlast_PDB 83.6149%-101 - C6 -2J7P 2.6 FTSY_THEAQ
15 PsiBlast_PDB 83.4849% -99 - C6 -2Q9C 6.5 FTSY_THEAQ
20 PsiBlast_PDB 83.4649%-108 - C6 -2IYL 7.3 FTSY_THEAQ
27 PsiBlast_CBE 82.4449%-100 - C6 -2J7P 2.7 FTSY_THEAQ
30 PsiBlast_CBE 82.3548% -96 - C6 -1RJ9 2.5 FTSY_THEAQ
14 PsiBlast_PDB 81.2049% -97 - C6 -2Q9B 5.9 FTSY_THEAQ
35 PsiBlast_CBE 80.0535% -95 - C6 -3DM5 7.0 SRP54_PYRFU
82 HHSearch 79.0142% -94 - C6 -3E70 7.1 ?
36 PsiBlast_CBE 78.0935% -97 - C6 -3DM5 7.6 SRP54_PYRFU
61 PsiBlast_CBE 77.5133% -88 - C6 -4C7O 3.0 SRP54_ECOLI
31 PsiBlast_CBE 76.5941% -93 - C6 -3E70 7.1 ?
86 HHSearch 76.4134% -97 - C6 -3DM5 7.5 SRP54_PYRFU
33 PsiBlast_CBE 76.0841% -95 - C6 -3DMD 3.4 ?
59 PsiBlast_CBE 75.9434% -84 - C6 -1RJ9 9.5 SRP54_THEAQ
45 PsiBlast_CBE 75.4534% -92 - C6 -2J7P 9.3 SRP54_THEAQ
46 PsiBlast_CBE 75.2534% -87 - C6 -2J7P 9.2 SRP54_THEAQ
32 PsiBlast_CBE 75.2441% -95 - C6 -3DMD 2.3 ?
43 PsiBlast_CBE 74.6234% -91 - C6 -3NG1 3.7 SRP54_THEAQ
34 PsiBlast_CBE 74.5341% -93 - C6 -3DMD 2.3 ?
44 PsiBlast_CBE 74.4634% -91 - C6 -3NG1 3.7 SRP54_THEAQ
62 PsiBlast_CBE 74.3333% -86 - C6 -4C7O 2.7 SRP54_ECOLI
51 PsiBlast_CBE 74.2234% -89 - C6 -1NG1 7.5 SRP54_THEAQ
40 PsiBlast_CBE 74.0834% -93 - C6 -1JPN 6.5 SRP54_THEAQ
42 PsiBlast_CBE 73.8834% -91 - C6 -1JPJ 7.6 SRP54_THEAQ
58 PsiBlast_CBE 73.8634% -91 - C6 -2NG1 6.2 SRP54_THEAQ
50 PsiBlast_CBE 73.8234% -86 - C6 -1OKK 2.4 SRP54_THEAQ
56 PsiBlast_CBE 73.8134% -88 - C6 -1O87 7.1 SRP54_THEAQ
57 PsiBlast_CBE 73.4634% -89 * C6 *1O87 7.1 SRP54_THEAQ
41 PsiBlast_CBE 73.0534% -90 - C6 -1JPN 7.5 SRP54_THEAQ