@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1840: (2016-03-29 )
MQKQVVVMDEAAIKRALTRVSYEIIERNKGTKNLALVGIKTRGIYLAERLHKRILEIEGIDVPVGDIDITLYRDDLSFKDDKTREPAVHGTNIPFDINGKKVVLVDDVLYTGRTVRAAMDALMDVGRPAQIHLAVLADRGHRELPIRADYVGKNIPTSGNERVEVRLTDVDHAEDAVIINKNE

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

5GP_B_7(4P86)
?
[Raw transfer]




5GP_D_11(4P86)
?
[Raw transfer]




5GP_C_10(4P86)
?
[Raw transfer]




U5P_D_8(4P83)
?
[Raw transfer]




5GP_A_5(4P86)
?
[Raw transfer]




U5P_A_3(2IGB)
PYRR_BACCL
[Raw transfer]




U5P_B_4(2IGB)
PYRR_BACCL
[Raw transfer]




U5P_B_6(4P83)
?
[Raw transfer]




U5P_A_5(4P83)
?
[Raw transfer]




U5P_C_7(4P83)
?
[Raw transfer]




U5P_B_7(1XZ8)
PYRR_BACCL
[Raw transfer]




5GP_A_5(1XZ8)
PYRR_BACCL
[Raw transfer]




GOL_C_8(4P81)
?
[Raw transfer]




3GP_A_6(1XZ8)
PYRR_BACCL
[Raw transfer]




34 PsiBlast_CBE 91.7966%-124 - C3 -4P86 6.4 ?
29 PsiBlast_CBE 91.5865%-124 - C3 -4P83 7.4 ?
30 PsiBlast_CBE 91.5565%-131 - C3 -4P83 5.2 ?
26 PsiBlast_CBE 91.4769%-122 - C3 -2IGB 6.3 PYRR_BACCL
13 PsiBlast_PDB 91.3766%-116 - C3 -4P86 7.1 ?
31 PsiBlast_CBE 91.2365%-127 - C3 -4P83 5.7 ?
32 PsiBlast_CBE 90.6366%-120 - C3 -4P86 6.6 ?
10 PsiBlast_PDB 90.5169%-123 * C3 *2IGB 6.7 PYRR_BACCL
33 PsiBlast_CBE 89.9566%-117 - C3 -4P86 6.7 ?
1 PsiBlast_PDB 89.5368%-117 - C3 -4P81 - ? -
3 PsiBlast_PDB 89.4468%-108 - C3 -4P84 - ? -
12 PsiBlast_PDB 88.9766%-105 - C3 -4P82 - PYRR_BACSU -
11 PsiBlast_PDB 88.8465%-129 - C3 -4P83 5.3 ?
2 PsiBlast_PDB 88.7168% -99 - C3 -4P3K - ? -
9 PsiBlast_PDB 88.6769%-135 - C3 -1XZN - PYRR_BACCL -
23 PsiBlast_CBE 88.3168%-112 - C3 -4P81 - ? -
25 PsiBlast_CBE 87.9566%-119 - C3 -1A4X - PYRR_BACSU -
5 PsiBlast_PDB 87.8966%-118 - C3 -1A4X - PYRR_BACSU -
22 PsiBlast_CBE 87.7668%-119 - C3 -4P81 2.8 ?
21 PsiBlast_CBE 87.1568%-115 - C3 -4P81 - ? -
8 PsiBlast_PDB 85.5869%-127 - C3 -1XZ8 5.1 PYRR_BACCL
28 PsiBlast_CBE 85.3169%-129 - C3 -1XZ8 5.0 PYRR_BACCL