@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1856: (2016-03-29 )
MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADN_A_2(3UAW)
DEOD_BACCE
[Raw transfer]




ADN_M_13(2AC7)
DEOD_BACAN
[Raw transfer]




ADN_A_2(3UAW)
DEOD_BACCE
[Raw transfer]




ADN_A_2(3UAY)
DEOD_BACCE
[Raw transfer]




ADN_Q_17(1PK7)
DEOD_ECO57
[Raw transfer]




2FA_B_4(4DAN)
DEOD_BACSU
[Raw transfer]




FMC_A_4(3UT6)
DEOD_ECOLI
[Raw transfer]




2FA_M_13(1PK9)
DEOD_ECO57
[Raw transfer]




2FA_A_3(4DAN)
DEOD_BACSU
[Raw transfer]




2FA_Q_17(1PK9)
DEOD_ECO57
[Raw transfer]




XYA_M_13(1PR6)
DEOD_ECO57
[Raw transfer]




FMC_B_6(3UT6)
DEOD_ECOLI
[Raw transfer]




FMC_C_9(3UT6)
DEOD_ECOLI
[Raw transfer]




2FA_O_15(1PK9)
DEOD_ECO57
[Raw transfer]




XYA_Q_17(1PR6)
DEOD_ECO57
[Raw transfer]




ADN_A_3(4D9H)
DEOD_BACSU
[Raw transfer]




TBN_Q_17(1PR5)
DEOD_ECO57
[Raw transfer]




TBN_M_13(1PR5)
DEOD_ECO57
[Raw transfer]




TBN_A_2(4DAR)
DEOD_BACSU
[Raw transfer]




ADN_M_13(1PK7)
DEOD_ECO57
[Raw transfer]




TBN_O_15(1PR5)
DEOD_ECO57
[Raw transfer]




NOS_A_2(3UAZ)
DEOD_BACCE
[Raw transfer]




XYA_O_15(1PR6)
DEOD_ECO57
[Raw transfer]




ADN_O_15(1PK7)
DEOD_ECO57
[Raw transfer]




2FD_O_15(1PKE)
DEOD_ECO57
[Raw transfer]




2FD_G_7(1Z34)
?
[Raw transfer]




2FD_Q_17(1PKE)
DEOD_ECO57
[Raw transfer]




GOL_A_9(4DAB)
DEOD_BACSU
[Raw transfer]




RAB_O_15(1PW7)
DEOD_ECO57
[Raw transfer]




RAB_M_13(1PW7)
DEOD_ECO57
[Raw transfer]




RAB_Q_17(1PW7)
DEOD_ECO57
[Raw transfer]




6CR_A_2(4DAE)
DEOD_BACSU
[Raw transfer]




2FD_M_13(1PKE)
DEOD_ECO57
[Raw transfer]




AC2_A_2(4DA7)
DEOD_BACSU
[Raw transfer]




GNG_A_2(4DA0)
DEOD_BACSU
[Raw transfer]




GA2_A_2(4DA6)
DEOD_BACSU
[Raw transfer]




BG2_A_2(4DA8)
DEOD_BACSU
[Raw transfer]




ADE_A_3(4DAO)
DEOD_BACSU
[Raw transfer]




ADE_B_4(4DAO)
DEOD_BACSU
[Raw transfer]




ADE_B_8(4D8V)
DEOD_BACSU
[Raw transfer]




HPA_A_2(4DAB)
DEOD_BACSU
[Raw transfer]




ADE_A_5(4D8V)
DEOD_BACSU
[Raw transfer]




TRS_M_13(1JE0)
PNPH_SULSO
[Raw transfer]




22 PsiBlast_CBE 96.2175%-119 - C1 -1XE3 - DEOD_BACAN -
31 PsiBlast_CBE 96.0770%-119 - C1 -4D8Y - DEOD_BACSU -
25 PsiBlast_CBE 95.8675%-117 - C1 -1XE3 - DEOD_BACAN -
4 PsiBlast_PDB 95.8675%-115 - C1 -3UAZ 5.0 DEOD_BACCE
3 PsiBlast_PDB 95.8475%-116 - C1 -3UAY 5.1 DEOD_BACCE
23 PsiBlast_CBE 95.8375%-115 - C1 -1XE3 - DEOD_BACAN -
2 PsiBlast_PDB 95.3575%-113 - C1 -3UAW 5.1 DEOD_BACCE
34 PsiBlast_CBE 95.2770%-120 - C1 -4D8Y - DEOD_BACSU -
35 PsiBlast_CBE 95.2270%-120 - C1 -4D8Y - DEOD_BACSU -
5 PsiBlast_PDB 95.0775%-116 - C1 -1XE3 - DEOD_BACAN -
24 PsiBlast_CBE 94.7975%-115 - C1 -1XE3 - DEOD_BACAN -
32 PsiBlast_CBE 94.5470%-121 - C1 -4D8Y - DEOD_BACSU -
33 PsiBlast_CBE 94.3870%-118 - C1 -4D8Y - DEOD_BACSU -
12 PsiBlast_PDB 94.3670%-117 - C1 -4DA6 4.6 DEOD_BACSU
26 PsiBlast_CBE 94.2675%-118 - C1 -1XE3 - DEOD_BACAN -
18 PsiBlast_PDB 94.1270%-120 - C1 -4DAO 3.1 DEOD_BACSU
10 PsiBlast_PDB 94.1270%-119 - C1 -4D9H 4.5 DEOD_BACSU
19 PsiBlast_PDB 94.0770%-119 - C1 -4DAR 4.5 DEOD_BACSU
17 PsiBlast_PDB 93.6970%-118 - C1 -4DAN 5.0 DEOD_BACSU
15 PsiBlast_PDB 93.5570%-117 - C1 -4DAB 4.0 DEOD_BACSU
13 PsiBlast_PDB 93.2970%-117 - C1 -4DA7 4.4 DEOD_BACSU
16 PsiBlast_PDB 93.0370%-117 - C1 -4DAE 5.2 DEOD_BACSU
36 PsiBlast_CBE 92.9870%-115 - C1 -4D8V 3.2 DEOD_BACSU
28 PsiBlast_CBE 92.8170%-119 - C1 -4DAN 5.0 DEOD_BACSU
121 HHSearch 92.8075%-109 - C1 -3UAW 5.1 DEOD_BACCE
14 PsiBlast_PDB 92.4470%-117 - C1 -4DA8 4.6 DEOD_BACSU
21 PsiBlast_CBE 91.8975%-123 - C1 -2AC7 5.0 DEOD_BACAN
6 PsiBlast_PDB 91.7870%-114 - C1 -4D8V 3.2 DEOD_BACSU
27 PsiBlast_CBE 91.4870%-116 - C1 -4DAO 3.1 DEOD_BACSU
11 PsiBlast_PDB 90.4870%-116 - C1 -4DA0 4.8 DEOD_BACSU
101 PsiBlast_CBE 87.1757%-113 - C1 -1PW7 4.3 DEOD_ECO57
104 PsiBlast_CBE 87.0357%-115 - C1 -1PR6 4.6 DEOD_ECO57
89 PsiBlast_CBE 86.3257%-110 - C1 -1PK9 5.3 DEOD_ECO57
102 PsiBlast_CBE 85.7857%-113 - C1 -1PW7 4.3 DEOD_ECO57
100 PsiBlast_CBE 85.6557%-112 * C1 *1PW7 4.0 DEOD_ECO57
103 PsiBlast_CBE 85.2857%-115 - C1 -1PR6 5.0 DEOD_ECO57
86 PsiBlast_CBE 85.1957%-110 - C1 -1PKE 4.6 DEOD_ECO57
90 PsiBlast_CBE 85.1357%-113 - C1 -1PK9 5.4 DEOD_ECO57
93 PsiBlast_CBE 84.8857%-111 - C1 -1PK7 4.7 DEOD_ECO57
87 PsiBlast_CBE 84.3357%-109 - C1 -1PKE 5.0 DEOD_ECO57
57 PsiBlast_CBE 84.1357%-104 - C1 -3UT6 4.9 DEOD_ECOLI
55 PsiBlast_CBE 84.1257%-108 - C1 -3UT6 4.4 DEOD_ECOLI
91 PsiBlast_CBE 84.0057%-111 - C1 -1PK7 5.0 DEOD_ECO57
105 PsiBlast_CBE 83.6257%-117 - C1 -1PR6 4.9 DEOD_ECO57
56 PsiBlast_CBE 83.5157%-107 - C1 -3UT6 4.2 DEOD_ECOLI
92 PsiBlast_CBE 83.4957%-110 - C1 -1PK7 4.3 DEOD_ECO57
88 PsiBlast_CBE 83.1357%-105 - C1 -1PK9 5.5 DEOD_ECO57
107 PsiBlast_CBE 82.7957%-116 - C1 -1PR5 4.7 DEOD_ECO57
85 PsiBlast_CBE 82.1157%-111 - C1 -1PKE 5.0 DEOD_ECO57
119 HHSearch 81.2152%-109 - C1 -1Z34 4.8 ?
108 PsiBlast_CBE 80.8957%-113 - C1 -1PR5 4.3 DEOD_ECO57
106 PsiBlast_CBE 79.7257%-105 - C1 -1PR5 4.8 DEOD_ECO57
127 HHSearch 71.5433%-112 - C1 -1JE0 2.5 PNPH_SULSO