Study : Lmo1873 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: TOP_A_3(2W9H) / Model_108(2W9H/A) = [3.3] Download1108.3438.22MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEFEADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
Complex: N22_A_5(3CSE) / Model_119(3CSE/A) = [3.9] Download1194.3550.50MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEFEADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
Complex: 5WB_A_4(3JWK) / Model_78(3JWK/A) = [4.5] Download1329.5438.71MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEFEADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
Complex: 5WB_B_6(3JWM) / Model_71(3JWM/B) = [4.6] Download1336.7840.52MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEFEADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
Complex: TOP_A_3(3TQ8) / Model_91(3TQ8/A) = [4.6] Download1283.0134.50MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEFEADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
Consensus
[pKd Mean = 4.18]
-1250
(s=87)
40
(s=5)
MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEFEADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN