@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1873: (2016-03-29 )
MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEFEADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN

Atome Classification :

(69 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EKB_B_6(3JVX)
?
[Raw transfer]




5DR_A_4(3S9U)
?
[Raw transfer]




6DR_A_4(3SA1)
?
[Raw transfer]




7DR_B_6(3SA2)
?
[Raw transfer]




EKB_A_4(3JVX)
?
[Raw transfer]




TOP_A_3(3TQ8)
?
[Raw transfer]




9DR_A_4(3SAI)
?
[Raw transfer]




5DR_B_6(3S9U)
?
[Raw transfer]




9DR_B_10(3SAI)
?
[Raw transfer]




TOP_A_3(2W9H)
DYR_STAAU
[Raw transfer]




5WA_B_6(3JWF)
?
[Raw transfer]




N22_B_6(3E0B)
?
[Raw transfer]




TOP_A_3(3TQ8)
?
[Raw transfer]




5WA_A_4(3JWF)
?
[Raw transfer]




6DR_B_6(3SA1)
?
[Raw transfer]




N22_A_4(3E0B)
?
[Raw transfer]




5WB_A_4(3JWK)
?
[Raw transfer]




5WB_B_6(3JWM)
?
[Raw transfer]




GOL_H_8(1ZDR)
?
[Raw transfer]




06U_B_9(4OSG)
?
[Raw transfer]




MTX_A_2(2QK8)
?
[Raw transfer]




FOL_A_3(3TQB)
?
[Raw transfer]




06U_D_19(4OSG)
?
[Raw transfer]




N22_A_5(3CSE)
?
[Raw transfer]




MTX_A_3(3TQ9)
?
[Raw transfer]




NDP_C_9(3IA4)
?
[Raw transfer]




NAP_B_6(2ZZA)
?
[Raw transfer]




NAP_A_3(4M7V)
?
[Raw transfer]




NDP_A_3(1AOE)
DYR_CANAX
[Raw transfer]




NDP_B_7(3IA4)
?
[Raw transfer]




NAP_A_3(3S9U)
?
[Raw transfer]




NAP_B_5(3E0B)
?
[Raw transfer]




NAP_B_9(3SAI)
?
[Raw transfer]




NDP_B_5(3IX9)
DYR_STRPN
[Raw transfer]




NAP_A_3(2ZZA)
?
[Raw transfer]




NDP_A_3(3IX9)
DYR_STRPN
[Raw transfer]




NAP_A_3(3JW3)
?
[Raw transfer]




NAP_A_3(3JWF)
?
[Raw transfer]




NAP_C_12(4OSG)
?
[Raw transfer]




NAP_A_3(3JWC)
?
[Raw transfer]




NAP_B_5(3S9U)
?
[Raw transfer]




NAP_A_3(3JVX)
?
[Raw transfer]




NAP_A_3(3SAI)
?
[Raw transfer]




NAP_A_3(3JW5)
?
[Raw transfer]




NAP_B_5(3JW3)
?
[Raw transfer]




NAP_A_3(3JWK)
?
[Raw transfer]




NAP_B_5(3JVX)
?
[Raw transfer]




NDP_A_3(3IX9)
DYR_STRPN
[Raw transfer]




NAP_A_3(3JWM)
?
[Raw transfer]




NAP_A_3(3E0B)
?
[Raw transfer]




NAP_B_5(3JW5)
?
[Raw transfer]




NAP_B_5(3JWM)
?
[Raw transfer]




NAP_B_5(3JWF)
?
[Raw transfer]




NAP_B_5(3SA2)
?
[Raw transfer]




NDP_D_11(3IA4)
?
[Raw transfer]




NAP_A_3(3SA1)
?
[Raw transfer]




NAP_A_3(3DAT)
?
[Raw transfer]




NDP_B_2(3DFR)
DYR_LACCA
[Raw transfer]




NAP_A_3(3SA2)
?
[Raw transfer]




NAP_B_5(3JWK)
?
[Raw transfer]




NAP_B_5(3SA1)
?
[Raw transfer]




NAP_A_2(4M7U)
?
[Raw transfer]




NAP_A_3(3S9U)
?
[Raw transfer]




NAP_B_5(3JWC)
?
[Raw transfer]




MTX_B_6(3IX9)
DYR_STRPN
[Raw transfer]




28 PsiBlast_CBE 95.6147%-119 - C1 -4ELH - ? -
49 PsiBlast_CBE 95.4847%-126 - C1 -4ELE - ? -
55 PsiBlast_CBE 95.3547%-117 - C1 -4ELB - ? -
10 PsiBlast_PDB 95.2847%-124 - C1 -4ELH - ? -
46 PsiBlast_CBE 95.0847%-122 - C1 -4ELE - ? -
67 PsiBlast_CBE 94.9647%-124 - C1 -3FL8 - ? -
48 PsiBlast_CBE 94.9647%-124 - C1 -4ELE - ? -
34 PsiBlast_CBE 94.8947%-122 - C1 -4ELG - ? -
68 PsiBlast_CBE 94.8847%-125 - C1 -3FL8 - ? -
51 PsiBlast_CBE 94.8847%-123 - C1 -4ELB - ? -
69 PsiBlast_CBE 94.7547%-122 - C1 -3FL8 - ? -
33 PsiBlast_CBE 94.6447%-122 - C1 -4ELG - ? -
56 PsiBlast_CBE 94.5147%-121 - C1 -4ELB - ? -
47 PsiBlast_CBE 94.4047%-126 - C1 -4ELE - ? -
66 PsiBlast_CBE 94.3647%-122 - C1 -3FL8 - ? -
24 PsiBlast_CBE 94.3647%-123 - C1 -4ELH - ? -
9 PsiBlast_PDB 94.3547%-124 - C1 -4ELG - ? -
40 PsiBlast_CBE 94.2647%-123 - C1 -4ELF - ? -
35 PsiBlast_CBE 94.1347%-120 - C1 -4ELG - ? -
22 PsiBlast_CBE 94.0547%-123 - C1 -4ELH - ? -
86 PsiBlast_CBE 92.2843%-124 - C1 -3IX9 10.6 DYR_STRPN
83 PsiBlast_CBE 92.2343%-111 - C1 -4M7U 9.4 ?
78 PsiBlast_CBE 92.2346%-117 - C1 -3JWK 12.6 ?
21 PsiBlast_CBE 92.2247%-121 - C1 -3JW3 12.3 ?
12 PsiBlast_PDB 92.1047%-120 - C1 -3JVX 12.5 ?
72 PsiBlast_CBE 91.9547%-117 - C1 -3JVX 13.0 ?
1 PsiBlast_PDB 91.7447%-120 - C1 -3JW3 11.8 ?
79 PsiBlast_CBE 91.7246%-119 - C1 -3JWF 12.5 ?
74 PsiBlast_CBE 91.7047%-118 - C1 -3SA2 12.1 ?
76 PsiBlast_CBE 91.6047%-116 - C1 -3S9U 12.4 ?
104 HHSearch 91.5947%-116 * C1 *3S9U 12.5 ?
11 PsiBlast_PDB 91.5847%-119 - C1 -3E0B 12.5 ?
82 PsiBlast_CBE 91.4743%-110 - C1 -4M7V 10.8 ?
70 PsiBlast_CBE 91.4247%-118 - C1 -3E0B 12.1 ?
80 PsiBlast_CBE 91.0946%-118 - C1 -3JWC 12.0 ?
77 PsiBlast_CBE 90.9746%-116 - C1 -3JWK 12.3 ?
75 PsiBlast_CBE 90.6147%-118 - C1 -3SA1 12.1 ?
73 PsiBlast_CBE 90.5747%-116 - C1 -3SAI 12.5 ?
15 PsiBlast_PDB 90.5747%-119 - C1 -3SA1 12.4 ?
14 PsiBlast_PDB 90.5747%-117 - C1 -3S9U 12.5 ?
71 PsiBlast_CBE 90.4947%-119 - C1 -3JWM 12.5 ?
17 PsiBlast_PDB 90.3147%-118 - C1 -3SAI 12.5 ?
81 PsiBlast_CBE 90.1546%-117 - C1 -3JW5 11.9 ?
19 PsiBlast_PDB 90.1446%-118 - C1 -3JWC 12.2 ?
16 PsiBlast_PDB 90.1447%-119 - C1 -3SA2 12.2 ?
20 PsiBlast_PDB 90.0346%-118 - C1 -3JWF 12.9 ?
2 PsiBlast_PDB 89.8247%-115 - C1 -2QK8 7.7 ?
3 PsiBlast_PDB 89.4347%-118 - C1 -3DAT 10.2 ?
18 PsiBlast_PDB 88.9046%-113 - C1 -3JW5 12.2 ?
84 PsiBlast_CBE 88.8742%-113 - C1 -1ZDR 2.4 ?
13 PsiBlast_PDB 88.8347%-115 - C1 -3JWM 11.9 ?
87 PsiBlast_CBE 88.0343%-116 - C1 -3IX9 11.1 DYR_STRPN
113 HHSearch 87.5043%-110 - C1 -3IX9 11.1 DYR_STRPN
99 PsiBlast_CBE 86.4341%-121 - C1 -3IA4 12.0 ?
108 HHSearch 86.2538%-121 - C1 -2W9H 3.3 DYR_STAAU
98 PsiBlast_CBE 85.8941%-122 - C1 -3IA4 11.5 ?
111 HHSearch 84.2039%-105 - C1 -3DFR 10.7 DYR_LACCA
97 PsiBlast_CBE 84.1341%-119 - C1 -3IA4 12.6 ?
94 PsiBlast_CBE 83.4741%-117 - C1 -2ZZA 11.4 ?
101 PsiBlast_CBE 83.0741%-120 - C1 -4OSG 10.2 ?
90 PsiBlast_CBE 81.9340%-125 - C1 -3TQ9 7.7 ?
93 PsiBlast_CBE 81.8041%-117 - C1 -2ZZA 10.9 ?
91 PsiBlast_CBE 81.7540%-116 - C1 -3TQ8 4.6 ?
100 PsiBlast_CBE 81.3941%-112 - C1 -4OSG 6.8 ?
103 HHSearch 81.1938%-117 - C1 -3TQ8 4.6 ?
102 PsiBlast_CBE 80.9041%-114 - C1 -4OSG 5.8 ?
88 PsiBlast_CBE 80.8740%-124 - C1 -3TQB 7.5 ?
119 HHSearch 63.7431% -93 - C1 -3CSE 3.9 ?
112 HHSearch 58.9232% -74 - C1 -1AOE 12.3 DYR_CANAX