Study : Lmo1879 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C4_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C4_S1
Complex: TRS_A_7(1C9O) / Model_66(1C9O/A) = [3.1] Download305.8534.60MQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQAVTFEVVEGNRGAQAANVEKA
Complex: TRS_A_7(1C9O) / Model_54(1C9O/A) = [3.1] Download271.5834.60MQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQAVTFEVVEGNRGAQAANVEKA
Complex: TRS_A_7(1C9O) / Model_4(1C9O/A) = [3.1] Download315.2934.60MQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQAVTFEVVEGNRGAQAANVEKA
Complex: CHAIN_R_3(3PF5) / Model_24(3PF5/B) = [6.7] Download--MQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQAVTFEVVEGNRGAQAANVEKA
Complex: CHAIN_R_3(3PF4) / Model_25(3PF4/B) = [7.3] Download--MQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQAVTFEVVEGNRGAQAANVEKA
Consensus
[pKd Mean = 4.66]
-297
(s=18)
34
(s=0)
MQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQAVTFEVVEGNRGAQAANVEKA