@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1904: (2016-03-30 )
MKNNREKLLALFTESDGTYLSGQEIADSLGCSRTAVWKQMEALRKEGFEIEAVRNRGYRLSATAEQYTKDALLLGLETKFIGQHLEVHESVNSTQIIAHQQIETSPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQIPIQKVPQFTFIASLAITEAIENITKLEPKIKWPNDIYIGKRKICGVLTEMQAEAETIHAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELFLDKGFAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDTLGEVHSIYSADILLDNEK

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BT5_C_3(2DVE)
?
[Raw transfer]




BT5_A_2(3V8L)
?
[Raw transfer]




BT5_B_4(2DKG)
?
[Raw transfer]




BTX_A_2(4DQ2)
?
[Raw transfer]




BT5_B_5(2DTI)
?
[Raw transfer]




BT5_B_4(1WQW)
?
[Raw transfer]




BT5_A_2(3RIR)
?
[Raw transfer]




BT5_B_3(2DXU)
?
[Raw transfer]




BT5_A_2(3RKW)
?
[Raw transfer]




32G_A_2(3V7R)
?
[Raw transfer]




BT5_C_3(2DZ9)
?
[Raw transfer]




BT5_B_4(2DKG)
?
[Raw transfer]




C77_A_2(3V7C)
?
[Raw transfer]




BT5_B_5(2DTI)
?
[Raw transfer]




ATP_D_4(2DXT)
?
[Raw transfer]




ATP_C_3(2DXT)
?
[Raw transfer]




ATP_A_4(1X01)
?
[Raw transfer]




36F_A_2(3V7S)
?
[Raw transfer]




ATP_A_3(3EFS)
?
[Raw transfer]




ATP_B_5(1X01)
?
[Raw transfer]




BTN_A_2(3V8K)
?
[Raw transfer]




ADP_B_4(1WNL)
?
[Raw transfer]




ADP_A_3(1WNL)
?
[Raw transfer]




BTN_A_2(3RKY)
?
[Raw transfer]




BTN_B_7(2EJG)
?
[Raw transfer]




ATP_B_7(3EFS)
?
[Raw transfer]




ADP_A_3(1WNL)
?
[Raw transfer]




BTN_A_5(2EJG)
?
[Raw transfer]




BC4_A_2(4HA8)
?
[Raw transfer]




BTN_B_7(3EFR)
?
[Raw transfer]




ADP_D_4(2DTH)
?
[Raw transfer]




ADP_C_3(2DTH)
?
[Raw transfer]




BTN_A_3(3EFR)
?
[Raw transfer]




6 PsiBlast_PDB 88.2735% -94 - C5 -3V7C 11.1 ?
3 PsiBlast_PDB 87.8235%-108 - C5 -3RKX - ? -
9 PsiBlast_PDB 87.7635%-112 - C5 -3V8J - ? -
4 PsiBlast_PDB 87.7335% -92 - C5 -3RKY 5.3 ?
8 PsiBlast_PDB 87.2935% -93 - C5 -3V7R 11.5 ?
7 PsiBlast_PDB 87.2635% -96 - C5 -3V7S 9.8 ?
59 HHSearch 87.2535%-104 - C5 -3RKX - ? -
12 PsiBlast_PDB 87.2436% -97 - C5 -4DQ2 11.2 ?
2 PsiBlast_PDB 87.1335% -91 - C5 -3RKW 11.2 ?
10 PsiBlast_PDB 87.0835% -99 - C5 -3V8K 5.6 ?
5 PsiBlast_PDB 86.9936% -99 - C5 -4HA8 5.2 ?
1 PsiBlast_PDB 86.9335% -93 - C5 -3RIR 9.4 ?
50 Fugue 86.2133%-105 - C5 -3RKX - ? -
11 PsiBlast_PDB 86.0635% -91 - C5 -3V8L 11.5 ?
13 PsiBlast_PDB 72.3531%-101 - C5 -1WNL 7.6 ?
20 PsiBlast_PDB 72.2131%-101 - C5 -2DJZ - ? -
51 Fugue 71.8933% -96 - C5 -1WNL 7.6 ?
16 PsiBlast_PDB 71.8631%-101 - C5 -1X01 6.5 ?
30 PsiBlast_CBE 71.8431%-102 - C5 -2DEQ - ? -
35 PsiBlast_CBE 71.7231%-102 - C5 -2DVE - ? -
17 PsiBlast_PDB 71.7031%-105 - C5 -2DKG 9.7 ?
26 PsiBlast_CBE 71.5131%-101 - C5 -1WNL 7.0 ?
39 PsiBlast_CBE 71.3931%-102 - C5 -2DXT 7.6 ?
24 PsiBlast_CBE 71.1331% -97 - C5 -1X01 5.2 ?
18 PsiBlast_PDB 71.1031% -99 - C5 -2DTH 4.9 ?
19 PsiBlast_PDB 70.9431%-105 - C5 -2DTI 8.5 ?
34 PsiBlast_CBE 70.6531% -99 - C5 -2DVE 8.0 ?
25 PsiBlast_CBE 70.4131% -99 - C5 -1WQW 10.7 ?
21 PsiBlast_CBE 70.3931%-100 - C5 -2DTI 8.1 ?
38 PsiBlast_CBE 70.1931% -99 - C5 -2DXT 6.4 ?
23 PsiBlast_CBE 69.9631% -98 - C5 -2DKG 10.1 ?
22 PsiBlast_CBE 69.8631% -97 - C5 -2DTH 4.7 ?
32 PsiBlast_CBE 69.6631%-101 - C5 -2EJG 6.2 ?
36 PsiBlast_CBE 69.5231% -98 - C5 -2DZ9 9.3 ?
31 PsiBlast_CBE 68.7431% -96 - C5 -2EJG 5.9 ?
33 PsiBlast_CBE 68.0431% -98 - C5 -2DXU 8.8 ?
40 PsiBlast_CBE 64.2637%-107 - C5 -3EFS 5.9 ?
43 PsiBlast_CBE 64.0836%-104 - C5 -3EFR 1.5 ?
41 PsiBlast_CBE 63.9337%-104 - C5 -3EFS 6.7 ?
42 PsiBlast_CBE 63.5836%-101 - C5 -3EFR 0.3 ?